BLASTX 7.6.2 Query= RU00790 /QuerySize=244 (243 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9GGG3|B9GGG3_POPTR Predicted protein OS=Populus trichocarpa ... 54 4e-006 >tr|B9GGG3|B9GGG3_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_642377 PE=4 SV=1 Length = 266 Score = 54 bits (127), Expect = 4e-006 Identities = 27/37 (72%), Gaps = 1/37 (2%) Frame = +1 Query: 130 FGQNQFFSSQRGPLQSSNTPSVHAWIDHNDLSDHQHQ 240 FGQNQFF SQRGPLQSSN PSV AWID DH Q Sbjct: 174 FGQNQFF-SQRGPLQSSNMPSVRAWIDPAITPDHHEQ 209 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 15,269,344,864 Number of Sequences: 7695149 Number of Extensions: 15269344864 Number of Successful Extensions: 25990560 Number of sequences better than 0.0: 0 |