BLASTX 7.6.2 Query= RU01667 /QuerySize=442 (441 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|Q9XEY5|Q9XEY5_TOBAC Nt-iaa28 deduced protein OS=Nicotiana tab... 90 4e-017 tr|Q9XEY6|Q9XEY6_TOBAC Nt-iaa4.1 deduced protein OS=Nicotiana ta... 90 4e-017 tr|A7QVQ0|A7QVQ0_VITVI Chromosome chr14 scaffold_190, whole geno... 88 1e-016 tr|B9I5F9|B9I5F9_POPTR Predicted protein OS=Populus trichocarpa ... 88 1e-016 tr|B3XZI2|B3XZI2_IPONI Auxin-responsive Aux/IAA gene family memb... 88 1e-016 tr|B9SZ69|B9SZ69_RICCO Auxin-responsive protein IAA16, putative ... 88 1e-016 tr|Q0WNJ2|Q0WNJ2_ARATH Auxin-induced protein OS=Arabidopsis thal... 88 1e-016 tr|Q0WRB1|Q0WRB1_ARATH IAA14 OS=Arabidopsis thaliana GN=At4g1455... 88 1e-016 tr|Q56WS6|Q56WS6_ARATH Auxin-induced protein OS=Arabidopsis thal... 88 1e-016 tr|A0MWP6|A0MWP6_SOLTU Auxin/indole-3-acetic acid OS=Solanum tub... 87 2e-016 tr|A2ZMF1|A2ZMF1_ORYSI Putative uncharacterized protein OS=Oryza... 87 2e-016 tr|A5B9V1|A5B9V1_VITVI Chromosome chr7 scaffold_31, whole genome... 87 2e-016 tr|A5H271|A5H271_CESEL IAA4 (Fragment) OS=Cestrum elegans GN=IAA... 87 2e-016 tr|A6N0C9|A6N0C9_ORYSI Osiaa30-auxin-responsive aux/iaa gene fam... 87 2e-016 tr|A6N157|A6N157_ORYSI Osiaa30-auxin-responsive aux/iaa gene fam... 87 2e-016 tr|A7NWZ8|A7NWZ8_VITVI Chromosome chr5 scaffold_2, whole genome ... 87 2e-016 tr|A9PCY8|A9PCY8_POPTR Predicted protein OS=Populus trichocarpa ... 87 2e-016 tr|B4FYI6|B4FYI6_MAIZE Putative uncharacterized protein OS=Zea m... 87 2e-016 tr|B4G1U0|B4G1U0_MAIZE Putative uncharacterized protein OS=Zea m... 87 2e-016 tr|B6TRR9|B6TRR9_MAIZE IAA30-auxin-responsive Aux/IAA family mem... 87 2e-016 tr|B8LKF9|B8LKF9_PICSI Putative uncharacterized protein OS=Picea... 87 2e-016 tr|B8LQ34|B8LQ34_PICSI Putative uncharacterized protein OS=Picea... 87 2e-016 tr|B9GE44|B9GE44_ORYSJ Putative uncharacterized protein OS=Oryza... 87 2e-016 tr|Q0PH24|Q0PH24_POPTO Auxin-regulated protein OS=Populus toment... 87 2e-016 tr|Q2QMK1|Q2QMK1_ORYSJ Os12g0601300 protein OS=Oryza sativa subs... 87 2e-016 tr|Q5U7K3|Q5U7K3_9POAL Auxin-induced protein (Fragment) OS=Sacch... 87 2e-016 tr|Q8LSK7|Q8LSK7_9ROSI Auxin-regulated protein OS=Populus tremul... 87 2e-016 tr|B7FGL7|B7FGL7_MEDTR Putative uncharacterized protein OS=Medic... 87 3e-016 tr|Q8H1U9|Q8H1U9_MIRJA Aux/IAA3 (Fragment) OS=Mirabilis jalapa P... 86 5e-016 tr|A9NVH5|A9NVH5_PICSI Putative uncharacterized protein OS=Picea... 86 7e-016 >tr|Q9XEY5|Q9XEY5_TOBAC Nt-iaa28 deduced protein OS=Nicotiana tabacum PE=2 SV=1 Length = 240 Score = 90 bits (221), Expect = 4e-017 Identities = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK KNRS Sbjct: 198 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 240 >tr|Q9XEY6|Q9XEY6_TOBAC Nt-iaa4.1 deduced protein OS=Nicotiana tabacum PE=2 SV=1 Length = 220 Score = 90 bits (221), Expect = 4e-017 Identities = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK KNRS Sbjct: 178 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 220 >tr|A7QVQ0|A7QVQ0_VITVI Chromosome chr14 scaffold_190, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00007456001 PE=3 SV=1 Length = 238 Score = 88 bits (217), Expect = 1e-016 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEK KNRS Sbjct: 196 DWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS 238 >tr|B9I5F9|B9I5F9_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_814326 PE=4 SV=1 Length = 246 Score = 88 bits (217), Expect = 1e-016 Identities = 41/42 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNR 127 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK KNR Sbjct: 204 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNR 245 >tr|B3XZI2|B3XZI2_IPONI Auxin-responsive Aux/IAA gene family member OS=Ipomoea nil GN=PnIAA1 PE=2 SV=1 Length = 225 Score = 88 bits (216), Expect = 1e-016 Identities = 41/43 (95%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEK KNRS Sbjct: 183 DWMLVGDVPWNMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 225 >tr|B9SZ69|B9SZ69_RICCO Auxin-responsive protein IAA16, putative OS=Ricinus communis GN=RCOM_0484470 PE=4 SV=1 Length = 257 Score = 88 bits (216), Expect = 1e-016 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEK KNRS Sbjct: 215 DWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKCKNRS 257 >tr|Q0WNJ2|Q0WNJ2_ARATH Auxin-induced protein OS=Arabidopsis thaliana GN=At3g04730 PE=2 SV=1 Length = 236 Score = 88 bits (216), Expect = 1e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EK KNRS Sbjct: 194 DWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 236 >tr|Q0WRB1|Q0WRB1_ARATH IAA14 OS=Arabidopsis thaliana GN=At4g14550 PE=2 SV=1 Length = 228 Score = 88 bits (216), Expect = 1e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKFKNRS Sbjct: 186 DWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS 228 >tr|Q56WS6|Q56WS6_ARATH Auxin-induced protein OS=Arabidopsis thaliana GN=At3g04730 PE=3 SV=1 Length = 71 Score = 88 bits (216), Expect = 1e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EK KNRS Sbjct: 29 DWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 71 >tr|A0MWP6|A0MWP6_SOLTU Auxin/indole-3-acetic acid OS=Solanum tuberosum GN=IAA2 PE=2 SV=1 Length = 213 Score = 87 bits (215), Expect = 2e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPW+MFVDSCKRLRIMKGSEAIGLAPRA+EK KNRS Sbjct: 171 DWMLVGDVPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS 213 >tr|A2ZMF1|A2ZMF1_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_39001 PE=3 SV=1 Length = 277 Score = 87 bits (214), Expect = 2e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK KNRS Sbjct: 235 DWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 277 >tr|A5B9V1|A5B9V1_VITVI Chromosome chr7 scaffold_31, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00023841001 PE=3 SV=1 Length = 235 Score = 87 bits (214), Expect = 2e-016 Identities = 40/43 (93%), Positives = 41/43 (95%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFVDSCKRLRIMKG EAIGLAPRA+EK KNRS Sbjct: 193 DWMLVGDVPWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNRS 235 >tr|A5H271|A5H271_CESEL IAA4 (Fragment) OS=Cestrum elegans GN=IAA4 PE=2 SV=1 Length = 149 Score = 87 bits (214), Expect = 2e-016 Identities = 41/43 (95%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEK KNRS Sbjct: 107 DWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 149 >tr|A6N0C9|A6N0C9_ORYSI Osiaa30-auxin-responsive aux/iaa gene family member, expressed (Fragment) OS=Oryza sativa subsp. indica PE=2 SV=1 Length = 85 Score = 87 bits (214), Expect = 2e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK KNRS Sbjct: 43 DWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 85 >tr|A6N157|A6N157_ORYSI Osiaa30-auxin-responsive aux/iaa gene family member (Fragment) OS=Oryza sativa subsp. indica PE=2 SV=1 Length = 87 Score = 87 bits (214), Expect = 2e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK KNRS Sbjct: 45 DWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 87 >tr|A7NWZ8|A7NWZ8_VITVI Chromosome chr5 scaffold_2, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00020121001 PE=3 SV=1 Length = 234 Score = 87 bits (214), Expect = 2e-016 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNR 127 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRA+EK KNR Sbjct: 192 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNR 233 >tr|A9PCY8|A9PCY8_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_827303 PE=2 SV=1 Length = 250 Score = 87 bits (214), Expect = 2e-016 Identities = 41/43 (95%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEK KNRS Sbjct: 208 DWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 250 >tr|B4FYI6|B4FYI6_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1 Length = 276 Score = 87 bits (214), Expect = 2e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK KNRS Sbjct: 234 DWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 276 >tr|B4G1U0|B4G1U0_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1 Length = 271 Score = 87 bits (214), Expect = 2e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK KNRS Sbjct: 229 DWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 271 >tr|B6TRR9|B6TRR9_MAIZE IAA30-auxin-responsive Aux/IAA family member OS=Zea mays PE=2 SV=1 Length = 275 Score = 87 bits (214), Expect = 2e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK KNRS Sbjct: 233 DWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 275 >tr|B8LKF9|B8LKF9_PICSI Putative uncharacterized protein OS=Picea sitchensis PE=2 SV=1 Length = 461 Score = 87 bits (214), Expect = 2e-016 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMF+DSCKRLRIMKGSEAIGLAPRA+EK KNR+ Sbjct: 419 DWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPRAMEKCKNRN 461 >tr|B8LQ34|B8LQ34_PICSI Putative uncharacterized protein OS=Picea sitchensis PE=2 SV=1 Length = 324 Score = 87 bits (214), Expect = 2e-016 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMF+DSCKRLRIMKGSEAIGLAPRA+EK KNR+ Sbjct: 282 DWMLVGDVPWEMFIDSCKRLRIMKGSEAIGLAPRAMEKCKNRN 324 >tr|B9GE44|B9GE44_ORYSJ Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_36765 PE=4 SV=1 Length = 183 Score = 87 bits (214), Expect = 2e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK KNRS Sbjct: 141 DWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 183 >tr|Q0PH24|Q0PH24_POPTO Auxin-regulated protein OS=Populus tomentosa PE=2 SV=1 Length = 258 Score = 87 bits (214), Expect = 2e-016 Identities = 41/43 (95%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEK KNRS Sbjct: 209 DWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 251 >tr|Q2QMK1|Q2QMK1_ORYSJ Os12g0601300 protein OS=Oryza sativa subsp. japonica GN=Os12g0601300 PE=2 SV=1 Length = 277 Score = 87 bits (214), Expect = 2e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK KNRS Sbjct: 235 DWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 277 >tr|Q5U7K3|Q5U7K3_9POAL Auxin-induced protein (Fragment) OS=Saccharum hybrid cultivar PE=2 SV=1 Length = 188 Score = 87 bits (214), Expect = 2e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRA+EK KNRS Sbjct: 146 DWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 188 >tr|Q8LSK7|Q8LSK7_9ROSI Auxin-regulated protein OS=Populus tremula x Populus tremuloides GN=IAA1 PE=2 SV=1 Length = 249 Score = 87 bits (214), Expect = 2e-016 Identities = 41/43 (95%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPW MFVDSCKRLRIMKGSEAIGLAPRAVEK KNRS Sbjct: 207 DWMLVGDVPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 249 >tr|B7FGL7|B7FGL7_MEDTR Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1 Length = 245 Score = 87 bits (213), Expect = 3e-016 Identities = 39/43 (90%), Positives = 41/43 (95%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMF+DSCKRLRIMKG EAIGLAPRA+EK KNRS Sbjct: 203 DWMLVGDVPWEMFIDSCKRLRIMKGKEAIGLAPRAMEKCKNRS 245 >tr|Q8H1U9|Q8H1U9_MIRJA Aux/IAA3 (Fragment) OS=Mirabilis jalapa PE=2 SV=1 Length = 48 Score = 86 bits (211), Expect = 5e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEK K+RS Sbjct: 6 DWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKCKSRS 48 >tr|A9NVH5|A9NVH5_PICSI Putative uncharacterized protein OS=Picea sitchensis PE=2 SV=1 Length = 390 Score = 86 bits (210), Expect = 7e-016 Identities = 39/43 (90%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFVDSCKRLRIMKGS+AIGLAPRA+EK K+RS Sbjct: 348 DWMLVGDVPWEMFVDSCKRLRIMKGSDAIGLAPRAMEKCKSRS 390 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,139,566,550 Number of Sequences: 7695149 Number of Extensions: 51139566550 Number of Successful Extensions: 45113940 Number of sequences better than 0.0: 0 |