BLASTX 7.6.2 Query= RU02130 /QuerySize=212 (211 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|Q9XGY3|Q9XGY3_MALDO Small zinc finger-like protein (Fragment)... 55 1e-006 >tr|Q9XGY3|Q9XGY3_MALDO Small zinc finger-like protein (Fragment) OS=Malus domestica GN=TIM8 PE=2 SV=1 Length = 71 Score = 55 bits (131), Expect = 1e-006 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = -2 Query: 102 MDPSVMQNPELASIINQEQQRAMVNEMVGKLTS 4 MDPS M NPEL + INQE++RAMVNEMVGKLT+ Sbjct: 1 MDPSAMNNPELLNFINQEKERAMVNEMVGKLTN 33 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,139,566,550 Number of Sequences: 7695149 Number of Extensions: 51139566550 Number of Successful Extensions: 45113940 Number of sequences better than 0.0: 0 |