BLASTX 7.6.2 Query= RU02152 /QuerySize=379 (378 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9SEJ1|B9SEJ1_RICCO Plastid-lipid-associated protein, chlorop... 57 3e-007 >tr|B9SEJ1|B9SEJ1_RICCO Plastid-lipid-associated protein, chloroplast, putative OS=Ricinus communis GN=RCOM_0705630 PE=4 SV=1 Length = 321 Score = 57 bits (136), Expect = 3e-007 Identities = 37/81 (45%), Positives = 44/81 (54%), Gaps = 7/81 (8%) Frame = +1 Query: 133 MAFVSQLNQFPCKTLSPTPRHPRLTSKPSTFAPNSIGLATPKLKLSNPEYPQAIRPATRI 312 MA +SQLNQFPCKTLS P + + TS+PS F SI T + P RP I Sbjct: 1 MASISQLNQFPCKTLSTPPCNSKFTSRPSVF---SIKTTT---SICRPTLSTGTRPVFSI 54 Query: 313 RAVD-EDESAPETSEEPSDVA 372 RAVD EDE P+ + VA Sbjct: 55 RAVDAEDEWGPDYEDSAVAVA 75 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,139,566,550 Number of Sequences: 7695149 Number of Extensions: 51139566550 Number of Successful Extensions: 45113940 Number of sequences better than 0.0: 0 |