BLASTX 7.6.2 Query= RU02303 /QuerySize=241 (240 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|A9RMD9|A9RMD9_PHYPA Predicted protein OS=Physcomitrella paten... 53 7e-006 tr|A9SJM0|A9SJM0_PHYPA Predicted protein OS=Physcomitrella paten... 53 7e-006 >tr|A9RMD9|A9RMD9_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_203892 PE=4 SV=1 Length = 272 Score = 53 bits (125), Expect = 7e-006 Identities = 20/32 (62%), Positives = 28/32 (87%) Frame = -2 Query: 122 IRIRSVWADNLDDEFDKIRSVIDEFPMISMDT 27 +RIR VWADNL+DEF+ IR ++DE+P ++MDT Sbjct: 10 LRIREVWADNLEDEFELIRDIVDEYPYVAMDT 41 >tr|A9SJM0|A9SJM0_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_185698 PE=4 SV=1 Length = 272 Score = 53 bits (125), Expect = 7e-006 Identities = 20/32 (62%), Positives = 28/32 (87%) Frame = -2 Query: 122 IRIRSVWADNLDDEFDKIRSVIDEFPMISMDT 27 +RIR VWADNL+DEF+ IR ++DE+P ++MDT Sbjct: 10 LRIREVWADNLEDEFELIRDIVDEYPYVAMDT 41 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,139,566,550 Number of Sequences: 7695149 Number of Extensions: 51139566550 Number of Successful Extensions: 45113940 Number of sequences better than 0.0: 0 |