BLASTX 7.6.2 Query= RU06045 /QuerySize=484 (483 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|Q9XIV0|Q9XIV0_CUCSA MRNA expressed in cucumber hypocotyls, O... 76 4e-013 tr|A5B9V1|A5B9V1_VITVI Chromosome chr7 scaffold_31, whole genome... 75 9e-013 tr|B2ZLE9|B2ZLE9_HELPE Indoleacetic acid-induced-like protein (F... 75 9e-013 tr|B2ZLF5|B2ZLF5_9ASTR Indoleacetic acid-induced-like protein (F... 75 9e-013 tr|B2ZLF7|B2ZLF7_9ASTR Indoleacetic acid-induced-like protein (F... 75 9e-013 tr|B7FGL7|B7FGL7_MEDTR Putative uncharacterized protein OS=Medic... 75 1e-012 tr|A2ZMF1|A2ZMF1_ORYSI Putative uncharacterized protein OS=Oryza... 74 1e-012 tr|A6N0C9|A6N0C9_ORYSI Osiaa30-auxin-responsive aux/iaa gene fam... 74 1e-012 tr|A6N157|A6N157_ORYSI Osiaa30-auxin-responsive aux/iaa gene fam... 74 1e-012 tr|B4FYI6|B4FYI6_MAIZE Putative uncharacterized protein OS=Zea m... 74 1e-012 tr|B4G1U0|B4G1U0_MAIZE Putative uncharacterized protein OS=Zea m... 74 1e-012 tr|B6TRR9|B6TRR9_MAIZE IAA30-auxin-responsive Aux/IAA family mem... 74 1e-012 tr|B9GE44|B9GE44_ORYSJ Putative uncharacterized protein OS=Oryza... 74 1e-012 tr|Q2QMK1|Q2QMK1_ORYSJ Os12g0601300 protein OS=Oryza sativa subs... 74 1e-012 tr|Q5U7K3|Q5U7K3_9POAL Auxin-induced protein (Fragment) OS=Sacch... 74 1e-012 tr|B2ZL95|B2ZL95_HELAN Indoleacetic acid-induced-like protein (F... 74 2e-012 tr|B2ZL75|B2ZL75_HELAN Indoleacetic acid-induced-like protein (F... 74 3e-012 tr|B2ZL76|B2ZL76_HELAN Indoleacetic acid-induced-like protein (F... 74 3e-012 tr|B2ZL77|B2ZL77_HELAN Indoleacetic acid-induced-like protein (F... 74 3e-012 tr|B2ZL78|B2ZL78_HELAN Indoleacetic acid-induced-like protein (F... 74 3e-012 tr|B2ZL86|B2ZL86_HELAN Indoleacetic acid-induced-like protein (F... 74 3e-012 tr|B2ZL92|B2ZL92_HELAN Indoleacetic acid-induced-like protein (F... 74 3e-012 tr|B2ZL93|B2ZL93_HELAN Indoleacetic acid-induced-like protein (F... 74 3e-012 tr|B2ZLB0|B2ZLB0_HELAN Indoleacetic acid-induced-like protein (F... 74 3e-012 tr|B2ZLB2|B2ZLB2_HELAN Indoleacetic acid-induced-like protein (F... 74 3e-012 tr|B2ZLC3|B2ZLC3_HELPE Indoleacetic acid-induced-like protein (F... 74 3e-012 tr|B8YIB9|B8YIB9_MIRJA Auxin-responsive protein IAA1 (Fragment) ... 74 3e-012 tr|Q8H1V1|Q8H1V1_MIRJA Aux/IAA1 (Fragment) OS=Mirabilis jalapa P... 74 3e-012 tr|Q8L5G7|Q8L5G7_MIRJA Auxin-responsive protein IAA1 (Fragment) ... 74 3e-012 tr|A7QVQ0|A7QVQ0_VITVI Chromosome chr14 scaffold_190, whole geno... 73 4e-012 >tr|Q9XIV0|Q9XIV0_CUCSA MRNA expressed in cucumber hypocotyls, OS=Cucumis sativus PE=2 SV=1 Length = 230 Score = 76 bits (186), Expect = 4e-013 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKGKEA+GLAPRAMEKCKNRS Sbjct: 196 PWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNRS 230 >tr|A5B9V1|A5B9V1_VITVI Chromosome chr7 scaffold_31, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00023841001 PE=3 SV=1 Length = 235 Score = 75 bits (183), Expect = 9e-013 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNRS Sbjct: 201 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNRS 235 >tr|B2ZLE9|B2ZLE9_HELPE Indoleacetic acid-induced-like protein (Fragment) OS=Helianthus petiolaris PE=3 SV=1 Length = 41 Score = 75 bits (183), Expect = 9e-013 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNRS Sbjct: 7 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNRS 41 >tr|B2ZLF5|B2ZLF5_9ASTR Indoleacetic acid-induced-like protein (Fragment) OS=Bahiopsis lanata PE=3 SV=1 Length = 41 Score = 75 bits (183), Expect = 9e-013 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNRS Sbjct: 7 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNRS 41 >tr|B2ZLF7|B2ZLF7_9ASTR Indoleacetic acid-induced-like protein (Fragment) OS=Bahiopsis reticulata PE=3 SV=1 Length = 41 Score = 75 bits (183), Expect = 9e-013 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNRS Sbjct: 7 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNRS 41 >tr|B7FGL7|B7FGL7_MEDTR Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1 Length = 245 Score = 75 bits (182), Expect = 1e-012 Identities = 32/35 (91%), Positives = 35/35 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMF++SCKRLRIMKGKEA+GLAPRAMEKCKNRS Sbjct: 211 PWEMFIDSCKRLRIMKGKEAIGLAPRAMEKCKNRS 245 >tr|A2ZMF1|A2ZMF1_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_39001 PE=3 SV=1 Length = 277 Score = 74 bits (181), Expect = 1e-012 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKG EA+GLAPRAMEKCKNRS Sbjct: 243 PWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 277 >tr|A6N0C9|A6N0C9_ORYSI Osiaa30-auxin-responsive aux/iaa gene family member, expressed (Fragment) OS=Oryza sativa subsp. indica PE=2 SV=1 Length = 85 Score = 74 bits (181), Expect = 1e-012 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKG EA+GLAPRAMEKCKNRS Sbjct: 51 PWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 85 >tr|A6N157|A6N157_ORYSI Osiaa30-auxin-responsive aux/iaa gene family member (Fragment) OS=Oryza sativa subsp. indica PE=2 SV=1 Length = 87 Score = 74 bits (181), Expect = 1e-012 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKG EA+GLAPRAMEKCKNRS Sbjct: 53 PWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 87 >tr|B4FYI6|B4FYI6_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1 Length = 276 Score = 74 bits (181), Expect = 1e-012 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKG EA+GLAPRAMEKCKNRS Sbjct: 242 PWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 276 >tr|B4G1U0|B4G1U0_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1 Length = 271 Score = 74 bits (181), Expect = 1e-012 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKG EA+GLAPRAMEKCKNRS Sbjct: 237 PWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 271 >tr|B6TRR9|B6TRR9_MAIZE IAA30-auxin-responsive Aux/IAA family member OS=Zea mays PE=2 SV=1 Length = 275 Score = 74 bits (181), Expect = 1e-012 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKG EA+GLAPRAMEKCKNRS Sbjct: 241 PWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 275 >tr|B9GE44|B9GE44_ORYSJ Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_36765 PE=4 SV=1 Length = 183 Score = 74 bits (181), Expect = 1e-012 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKG EA+GLAPRAMEKCKNRS Sbjct: 149 PWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 183 >tr|Q2QMK1|Q2QMK1_ORYSJ Os12g0601300 protein OS=Oryza sativa subsp. japonica GN=Os12g0601300 PE=2 SV=1 Length = 277 Score = 74 bits (181), Expect = 1e-012 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKG EA+GLAPRAMEKCKNRS Sbjct: 243 PWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 277 >tr|Q5U7K3|Q5U7K3_9POAL Auxin-induced protein (Fragment) OS=Saccharum hybrid cultivar PE=2 SV=1 Length = 188 Score = 74 bits (181), Expect = 1e-012 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKG EA+GLAPRAMEKCKNRS Sbjct: 154 PWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 188 >tr|B2ZL95|B2ZL95_HELAN Indoleacetic acid-induced-like protein (Fragment) OS=Helianthus annuus PE=3 SV=1 Length = 41 Score = 74 bits (180), Expect = 2e-012 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = +1 Query: 25 LVVLFPWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 LV PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNR Sbjct: 2 LVGDLPWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR 40 >tr|B2ZL75|B2ZL75_HELAN Indoleacetic acid-induced-like protein (Fragment) OS=Helianthus annuus PE=3 SV=1 Length = 41 Score = 74 bits (179), Expect = 3e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNR Sbjct: 7 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR 40 >tr|B2ZL76|B2ZL76_HELAN Indoleacetic acid-induced-like protein (Fragment) OS=Helianthus annuus PE=3 SV=1 Length = 41 Score = 74 bits (179), Expect = 3e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNR Sbjct: 7 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR 40 >tr|B2ZL77|B2ZL77_HELAN Indoleacetic acid-induced-like protein (Fragment) OS=Helianthus annuus PE=3 SV=1 Length = 41 Score = 74 bits (179), Expect = 3e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNR Sbjct: 7 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR 40 >tr|B2ZL78|B2ZL78_HELAN Indoleacetic acid-induced-like protein (Fragment) OS=Helianthus annuus PE=3 SV=1 Length = 38 Score = 74 bits (179), Expect = 3e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNR Sbjct: 4 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR 37 >tr|B2ZL86|B2ZL86_HELAN Indoleacetic acid-induced-like protein (Fragment) OS=Helianthus annuus PE=3 SV=1 Length = 40 Score = 74 bits (179), Expect = 3e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNR Sbjct: 6 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR 39 >tr|B2ZL92|B2ZL92_HELAN Indoleacetic acid-induced-like protein (Fragment) OS=Helianthus annuus PE=3 SV=1 Length = 41 Score = 74 bits (179), Expect = 3e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNR Sbjct: 7 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR 40 >tr|B2ZL93|B2ZL93_HELAN Indoleacetic acid-induced-like protein (Fragment) OS=Helianthus annuus PE=3 SV=1 Length = 39 Score = 74 bits (179), Expect = 3e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNR Sbjct: 5 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR 38 >tr|B2ZLB0|B2ZLB0_HELAN Indoleacetic acid-induced-like protein (Fragment) OS=Helianthus annuus PE=3 SV=1 Length = 37 Score = 74 bits (179), Expect = 3e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNR Sbjct: 3 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR 36 >tr|B2ZLB2|B2ZLB2_HELAN Indoleacetic acid-induced-like protein (Fragment) OS=Helianthus annuus PE=3 SV=1 Length = 36 Score = 74 bits (179), Expect = 3e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNR Sbjct: 2 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR 35 >tr|B2ZLC3|B2ZLC3_HELPE Indoleacetic acid-induced-like protein (Fragment) OS=Helianthus petiolaris PE=3 SV=1 Length = 41 Score = 74 bits (179), Expect = 3e-012 Identities = 32/34 (94%), Positives = 34/34 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNR Sbjct: 7 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNR 40 >tr|B8YIB9|B8YIB9_MIRJA Auxin-responsive protein IAA1 (Fragment) OS=Mirabilis jalapa PE=2 SV=1 Length = 263 Score = 74 bits (179), Expect = 3e-012 Identities = 33/34 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 PWEMFVESCKRLRIMKGKEA GLAPRAMEKCKNR Sbjct: 229 PWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR 262 >tr|Q8H1V1|Q8H1V1_MIRJA Aux/IAA1 (Fragment) OS=Mirabilis jalapa PE=2 SV=1 Length = 97 Score = 74 bits (179), Expect = 3e-012 Identities = 33/34 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 PWEMFVESCKRLRIMKGKEA GLAPRAMEKCKNR Sbjct: 63 PWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR 96 >tr|Q8L5G7|Q8L5G7_MIRJA Auxin-responsive protein IAA1 (Fragment) OS=Mirabilis jalapa PE=2 SV=1 Length = 194 Score = 74 bits (179), Expect = 3e-012 Identities = 33/34 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNR 141 PWEMFVESCKRLRIMKGKEA GLAPRAMEKCKNR Sbjct: 160 PWEMFVESCKRLRIMKGKEAAGLAPRAMEKCKNR 193 >tr|A7QVQ0|A7QVQ0_VITVI Chromosome chr14 scaffold_190, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00007456001 PE=3 SV=1 Length = 238 Score = 73 bits (177), Expect = 4e-012 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKG EA+GLAPRA+EKCKNRS Sbjct: 204 PWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS 238 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 136,774,257,026 Number of Sequences: 7695149 Number of Extensions: 136774257026 Number of Successful Extensions: 108907339 Number of sequences better than 0.0: 0 |