BLASTX 7.6.2 Query= RU11901 /QuerySize=246 (245 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9HCU9|B9HCU9_POPTR Predicted protein OS=Populus trichocarpa ... 55 1e-006 tr|B9IH50|B9IH50_POPTR Predicted protein (Fragment) OS=Populus t... 52 9e-006 >tr|B9HCU9|B9HCU9_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_831764 PE=4 SV=1 Length = 579 Score = 55 bits (131), Expect = 1e-006 Identities = 23/31 (74%), Positives = 25/31 (80%) Frame = +2 Query: 152 MEAGHPAASKTEFTECWRTTWKTPYILRLAL 244 +E G A KTEFTECWRT WKTPYI+RLAL Sbjct: 2 VEGGVATADKTEFTECWRTVWKTPYIMRLAL 32 >tr|B9IH50|B9IH50_POPTR Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_254734 PE=4 SV=1 Length = 573 Score = 52 bits (124), Expect = 9e-006 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +2 Query: 152 MEAGHPAASKTEFTECWRTTWKTPYILRLA 241 +E G A KTEFTECW+T WKTPYI+RLA Sbjct: 2 VEGGVTTADKTEFTECWKTVWKTPYIMRLA 31 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 238,984,549,459 Number of Sequences: 7695149 Number of Extensions: 238984549459 Number of Successful Extensions: 196034722 Number of sequences better than 0.0: 0 |