BLASTX 7.6.2 Query= RU12094 /QuerySize=225 (224 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9RZK3|B9RZK3_RICCO Putative uncharacterized protein OS=Ricin... 61 2e-008 tr|A7Q8K6|A7Q8K6_VITVI Chromosome chr5 scaffold_64, whole genome... 60 5e-008 tr|B9HX03|B9HX03_POPTR Predicted protein OS=Populus trichocarpa ... 56 6e-007 tr|B9NH42|B9NH42_POPTR Predicted protein OS=Populus trichocarpa ... 56 6e-007 >tr|B9RZK3|B9RZK3_RICCO Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0999300 PE=4 SV=1 Length = 416 Score = 61 bits (146), Expect = 2e-008 Identities = 32/58 (55%), Positives = 38/58 (65%), Gaps = 6/58 (10%) Frame = -1 Query: 158 ESDDCATSHS-----SGSGREAL-SEAANLDRFLEFTTPLARAHFLPKTSSRGWRTHE 3 ESD C +S S S SGR + + NLDRFLE+TTP+ A +LPKTS RGWR HE Sbjct: 59 ESDQCGSSSSSVSNCSVSGRVGIEGNSTNLDRFLEYTTPVVPAQYLPKTSVRGWRNHE 116 >tr|A7Q8K6|A7Q8K6_VITVI Chromosome chr5 scaffold_64, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00033091001 PE=4 SV=1 Length = 357 Score = 60 bits (143), Expect = 5e-008 Identities = 28/57 (49%), Positives = 37/57 (64%), Gaps = 2/57 (3%) Frame = -1 Query: 173 PVSVVESDDCATSHSSGSGREALSEAANLDRFLEFTTPLARAHFLPKTSSRGWRTHE 3 P S E DDC+++ S + L ++ NLDRFLE+TTP+ A PKTS RGWR H+ Sbjct: 19 PESRTELDDCSSTCS--VSHQGLGDSTNLDRFLEYTTPVVPAQHFPKTSMRGWRNHQ 73 >tr|B9HX03|B9HX03_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_833344 PE=4 SV=1 Length = 397 Score = 56 bits (134), Expect = 6e-007 Identities = 32/53 (60%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -1 Query: 158 ESDDCATSHSSGSGREA-LSEAANLDRFLEFTTPLARAHFLPKTSSRGWRTHE 3 ESD C S+ S SGR S + NLDRFLE+TTP+ A FLPKTS R WRT E Sbjct: 57 ESDQCG-SNCSVSGRVGPESNSTNLDRFLEYTTPVVPAQFLPKTSVREWRTCE 108 >tr|B9NH42|B9NH42_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_583977 PE=4 SV=1 Length = 171 Score = 56 bits (134), Expect = 6e-007 Identities = 32/53 (60%), Positives = 36/53 (67%), Gaps = 2/53 (3%) Frame = -1 Query: 158 ESDDCATSHSSGSGREA-LSEAANLDRFLEFTTPLARAHFLPKTSSRGWRTHE 3 ESD C S+ S SGR S + NLDRFLE+TTP+ A FLPKTS R WRT E Sbjct: 57 ESDQCG-SNCSVSGRVGPESNSTNLDRFLEYTTPVVPAQFLPKTSVREWRTCE 108 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 258,946,417,704 Number of Sequences: 7695149 Number of Extensions: 258946417704 Number of Successful Extensions: 196808417 Number of sequences better than 0.0: 0 |