BLASTX 7.6.2 Query= RU12852 /QuerySize=632 (631 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|A7QFQ2|A7QFQ2_VITVI Chromosome chr8 scaffold_88, whole genome... 76 2e-012 tr|B9IGV1|B9IGV1_POPTR Predicted protein OS=Populus trichocarpa ... 64 9e-009 tr|B9HDJ9|B9HDJ9_POPTR Predicted protein OS=Populus trichocarpa ... 61 6e-008 >tr|A7QFQ2|A7QFQ2_VITVI Chromosome chr8 scaffold_88, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00037508001 PE=4 SV=1 Length = 120 Score = 76 bits (185), Expect = 2e-012 Identities = 34/56 (60%), Positives = 40/56 (71%) Frame = +2 Query: 413 MVLSKLPDSSKTRKCNPVQTQLLFPMGQMDAVVSDHVELDFSDVFGPVPVHAPVDS 580 MV S +P +KTR C P+Q QLLFPM D V DHVELDF+DVFGP+PV P D+ Sbjct: 1 MVFSDVPGLTKTRMCKPIQNQLLFPMNPTDIVPLDHVELDFADVFGPLPVQTPTDT 56 >tr|B9IGV1|B9IGV1_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_577198 PE=4 SV=1 Length = 475 Score = 64 bits (153), Expect = 9e-009 Identities = 31/55 (56%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = +2 Query: 467 QTQLLFPMGQMDAVVSDHVELDFSDVFGPVPVHAPVDSANSASVEDGADHIYDDP 631 + +LLFP+ D VVSDHVELDF+DVFGP+P V+ + SV DG++ IYDDP Sbjct: 11 KNRLLFPVNPSDTVVSDHVELDFTDVFGPLP-SIDVNCGDPLSVGDGSELIYDDP 64 >tr|B9HDJ9|B9HDJ9_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_819242 PE=4 SV=1 Length = 475 Score = 61 bits (146), Expect = 6e-008 Identities = 29/55 (52%), Positives = 40/55 (72%), Gaps = 1/55 (1%) Frame = +2 Query: 467 QTQLLFPMGQMDAVVSDHVELDFSDVFGPVPVHAPVDSANSASVEDGADHIYDDP 631 + +LLFP+ +D VSDHVELDF+DVFGP+P V+ + SV DG++ IYD+P Sbjct: 11 KNRLLFPVNSLDTEVSDHVELDFTDVFGPLP-SIDVNCGDPLSVGDGSELIYDNP 64 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 258,946,417,704 Number of Sequences: 7695149 Number of Extensions: 258946417704 Number of Successful Extensions: 196808417 Number of sequences better than 0.0: 0 |