BLASTX 7.6.2 Query= RU17333 /QuerySize=257 (256 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9GR88|B9GR88_POPTR Predicted protein OS=Populus trichocarpa ... 75 9e-013 tr|B9S570|B9S570_RICCO Putative uncharacterized protein OS=Ricin... 71 2e-011 tr|A5B0I1|A5B0I1_VITVI Putative uncharacterized protein OS=Vitis... 56 6e-007 >tr|B9GR88|B9GR88_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_645504 PE=4 SV=1 Length = 145 Score = 75 bits (184), Expect = 9e-013 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = +1 Query: 1 AKQTVQDAWGSAKDTAQKAADNVMGKAQESKEFVKENAEQVKKSMNTK 144 AKQT QDAWG+ KDT K D V+GKA+ESKEF+KENAE VK SMNTK Sbjct: 97 AKQTAQDAWGAVKDTTAKIKDTVVGKAEESKEFIKENAETVKSSMNTK 144 >tr|B9S570|B9S570_RICCO Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1721910 PE=4 SV=1 Length = 153 Score = 71 bits (173), Expect = 2e-011 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +1 Query: 1 AKQTVQDAWGSAKDTAQKAADNVMGKAQESKEFVKENAEQVKKSMNTK 144 AKQTV+ AWGS KDT QK D +G A+ESKEFVKENA+ VK+SMN+K Sbjct: 105 AKQTVEGAWGSVKDTTQKIKDTAVGLAEESKEFVKENADSVKRSMNSK 152 >tr|A5B0I1|A5B0I1_VITVI Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_022655 PE=4 SV=1 Length = 145 Score = 56 bits (134), Expect = 6e-007 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 7/48 (14%) Frame = +1 Query: 1 AKQTVQDAWGSAKDTAQKAADNVMGKAQESKEFVKENAEQVKKSMNTK 144 AKQTVQ AWGS K+T V GK +E+KE VK+NAE VK++MNTK Sbjct: 104 AKQTVQGAWGSVKET-------VAGKTEEAKECVKDNAETVKRNMNTK 144 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 309,246,347,612 Number of Sequences: 7695149 Number of Extensions: 309246347612 Number of Successful Extensions: 246574083 Number of sequences better than 0.0: 0 |