BLASTX 7.6.2 Query= RU17609 /QuerySize=311 (310 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9RMR2|B9RMR2_RICCO Steroid dehydrogenase, putative OS=Ricinu... 94 2e-018 tr|B9HLC5|B9HLC5_POPTR Predicted protein OS=Populus trichocarpa ... 88 2e-016 tr|B9HTF0|B9HTF0_POPTR Predicted protein OS=Populus trichocarpa ... 87 2e-016 tr|Q0VH88|Q0VH88_GOSHI 3-ketoacyl-CoA reductase 1 OS=Gossypium h... 87 2e-016 tr|A7P451|A7P451_VITVI Chromosome chr1 scaffold_5, whole genome ... 80 5e-014 tr|Q84X95|Q84X95_BRANA Putative 3-ketoacyl-CoA reductase 2 OS=Br... 77 2e-013 tr|Q84X96|Q84X96_BRANA Putative 3-ketoacyl-CoA reductase 1 OS=Br... 77 4e-013 tr|B9HLC3|B9HLC3_POPTR Predicted protein OS=Populus trichocarpa ... 72 1e-011 tr|Q8L9C4|Q8L9C4_ARATH Putative uncharacterized protein OS=Arabi... 70 5e-011 tr|B9HTE8|B9HTE8_POPTR Predicted protein OS=Populus trichocarpa ... 67 4e-010 tr|Q0VH87|Q0VH87_GOSHI 3-ketoacyl-CoA reductase 2 OS=Gossypium h... 67 4e-010 tr|B9RMQ7|B9RMQ7_RICCO Steroid dehydrogenase, putative OS=Ricinu... 61 2e-008 tr|B9RMQ9|B9RMQ9_RICCO Steroid dehydrogenase, putative OS=Ricinu... 60 4e-008 tr|B8LS27|B8LS27_PICSI Putative uncharacterized protein OS=Picea... 60 5e-008 tr|B3VXM4|B3VXM4_POPTN Short-chain dehydrogenase/reductase (Frag... 57 3e-007 tr|B3VXM6|B3VXM6_POPTN Short-chain dehydrogenase/reductase (Frag... 57 3e-007 tr|B3VXN0|B3VXN0_POPTN Short-chain dehydrogenase/reductase (Frag... 57 3e-007 tr|B3VXN1|B3VXN1_POPTN Short-chain dehydrogenase/reductase (Frag... 57 3e-007 tr|B3VXN4|B3VXN4_POPTN Short-chain dehydrogenase/reductase (Frag... 57 3e-007 tr|B3VXP7|B3VXP7_POPTN Short-chain dehydrogenase/reductase (Frag... 57 3e-007 tr|B3VXQ4|B3VXQ4_POPTN Short-chain dehydrogenase/reductase (Frag... 57 3e-007 tr|A7P443|A7P443_VITVI Chromosome chr1 scaffold_5, whole genome ... 57 4e-007 tr|B3VYP4|B3VYP4_POPTN Short-chain dehydrogenase/reductase (Frag... 55 1e-006 tr|B9RMR1|B9RMR1_RICCO Steroid dehydrogenase, putative OS=Ricinu... 55 1e-006 tr|B3VYS2|B3VYS2_POPTN Short-chain dehydrogenase/reductase (Frag... 55 2e-006 tr|O24479|O24479_HORVU B-keto acyl reductase OS=Hordeum vulgare ... 54 3e-006 tr|A9RZJ1|A9RZJ1_PHYPA Predicted protein OS=Physcomitrella paten... 54 4e-006 tr|O24478|O24478_MAIZE Putative uncharacterized protein OS=Zea m... 53 5e-006 tr|Q8RUZ2|Q8RUZ2_MAIZE Beta-keto acyl reductase (Fragment) OS=Ze... 53 5e-006 >tr|B9RMR2|B9RMR2_RICCO Steroid dehydrogenase, putative OS=Ricinus communis GN=RCOM_1082860 PE=4 SV=1 Length = 320 Score = 94 bits (232), Expect = 2e-018 Identities = 43/59 (72%), Positives = 51/59 (86%), Gaps = 1/59 (1%) Frame = +3 Query: 132 CFILGRLKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTGP 308 CF+ +LK+QP W L LFS+GSLS+LR ++LNWV+VNFLRPAKNLKKYGSWALVTGP Sbjct: 4 CFV-DKLKSQPLWFLVLFSLGSLSLLRCFFTILNWVYVNFLRPAKNLKKYGSWALVTGP 61 >tr|B9HLC5|B9HLC5_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_766594 PE=4 SV=1 Length = 320 Score = 88 bits (216), Expect = 2e-016 Identities = 38/56 (67%), Positives = 49/56 (87%) Frame = +3 Query: 141 LGRLKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTGP 308 + +LK QP+W+L LF++GSLS+L+F + L WV+V+FLRPAKNLKKYGSWALVTGP Sbjct: 6 IDQLKDQPFWLLLLFTLGSLSLLKFLSATLKWVYVSFLRPAKNLKKYGSWALVTGP 61 >tr|B9HTF0|B9HTF0_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_821856 PE=4 SV=1 Length = 320 Score = 87 bits (215), Expect = 2e-016 Identities = 40/59 (67%), Positives = 49/59 (83%), Gaps = 1/59 (1%) Frame = +3 Query: 132 CFILGRLKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTGP 308 CF+ LK+QP W+L LF++GSLS L+F + L WV+V+FLRPAKNLKKYGSWALVTGP Sbjct: 4 CFV-DELKSQPSWLLVLFTLGSLSFLKFLFASLKWVYVSFLRPAKNLKKYGSWALVTGP 61 >tr|Q0VH88|Q0VH88_GOSHI 3-ketoacyl-CoA reductase 1 OS=Gossypium hirsutum PE=2 SV=1 Length = 320 Score = 87 bits (215), Expect = 2e-016 Identities = 38/61 (62%), Positives = 47/61 (77%) Frame = +3 Query: 126 MDCFILGRLKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTG 305 M+ LK QP+WV+ LF++GSLS+L+FS L WV++NFLRP KNLKKYGSW LVTG Sbjct: 1 MEACFFDTLKAQPFWVIFLFTLGSLSLLKFSFVFLKWVWINFLRPGKNLKKYGSWGLVTG 60 Query: 306 P 308 P Sbjct: 61 P 61 >tr|A7P451|A7P451_VITVI Chromosome chr1 scaffold_5, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00030698001 PE=3 SV=1 Length = 320 Score = 80 bits (195), Expect = 5e-014 Identities = 35/61 (57%), Positives = 48/61 (78%) Frame = +3 Query: 126 MDCFILGRLKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTG 305 M+ + +L+TQP WV+ LF++G LS+L+ +++LN V+V FLRP KNLKKYGSWALVT Sbjct: 1 MELCFMEKLQTQPLWVIVLFAVGCLSVLKSFLAILNGVYVCFLRPGKNLKKYGSWALVTA 60 Query: 306 P 308 P Sbjct: 61 P 61 >tr|Q84X95|Q84X95_BRANA Putative 3-ketoacyl-CoA reductase 2 OS=Brassica napus PE=2 SV=1 Length = 319 Score = 77 bits (189), Expect = 2e-013 Identities = 31/52 (59%), Positives = 46/52 (88%) Frame = +3 Query: 153 KTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTGP 308 K+QP W+L LFS+GS+SILRF++++L +++ FLRP KNL++YGSWA++TGP Sbjct: 8 KSQPTWLLVLFSLGSISILRFTLTLLTSLYIYFLRPGKNLRRYGSWAIITGP 59 >tr|Q84X96|Q84X96_BRANA Putative 3-ketoacyl-CoA reductase 1 OS=Brassica napus PE=2 SV=1 Length = 319 Score = 77 bits (187), Expect = 4e-013 Identities = 31/52 (59%), Positives = 45/52 (86%) Frame = +3 Query: 153 KTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTGP 308 K+QP W+L LFS+GS+SILRF+ ++L +++ FLRP KNL++YGSWA++TGP Sbjct: 8 KSQPTWLLVLFSLGSISILRFTFTLLTSLYIYFLRPGKNLRRYGSWAIITGP 59 >tr|B9HLC3|B9HLC3_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_565101 PE=4 SV=1 Length = 214 Score = 72 bits (175), Expect = 1e-011 Identities = 31/55 (56%), Positives = 40/55 (72%) Frame = +3 Query: 141 LGRLKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTG 305 + L TQP W++ + S+G LS L+ S S+L WV+ FLRP KNLK YGSWAL+TG Sbjct: 6 INHLLTQPMWLILVSSLGFLSFLKTSTSLLKWVYATFLRPKKNLKDYGSWALITG 60 >tr|Q8L9C4|Q8L9C4_ARATH Putative uncharacterized protein OS=Arabidopsis thaliana PE=2 SV=1 Length = 318 Score = 70 bits (169), Expect = 5e-011 Identities = 28/52 (53%), Positives = 42/52 (80%) Frame = +3 Query: 153 KTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTGP 308 K+QP W+L LF +GS+SI +F ++L ++ FLRP+KNL++YGSWA++TGP Sbjct: 8 KSQPTWLLILFVLGSISIFKFIFTLLRSFYIYFLRPSKNLRRYGSWAIITGP 59 >tr|B9HTE8|B9HTE8_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_565949 PE=4 SV=1 Length = 319 Score = 67 bits (161), Expect = 4e-010 Identities = 28/52 (53%), Positives = 38/52 (73%) Frame = +3 Query: 150 LKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTG 305 L TQP W+L S+G +S L+ S +LNWV+ FLRP ++LK YGSWA++TG Sbjct: 9 LLTQPMWLLLFSSLGFISFLKTSTLLLNWVYATFLRPKRDLKDYGSWAVITG 60 >tr|Q0VH87|Q0VH87_GOSHI 3-ketoacyl-CoA reductase 2 OS=Gossypium hirsutum PE=2 SV=1 Length = 307 Score = 67 bits (161), Expect = 4e-010 Identities = 30/49 (61%), Positives = 35/49 (71%) Frame = +3 Query: 159 QPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTG 305 QP W+LAL +G LS L S+S+LNWVF F R KNL YGSWAL+TG Sbjct: 2 QPTWLLALSFLGFLSFLTRSISLLNWVFTTFFRSPKNLNNYGSWALITG 50 >tr|B9RMQ7|B9RMQ7_RICCO Steroid dehydrogenase, putative OS=Ricinus communis GN=RCOM_1082610 PE=4 SV=1 Length = 331 Score = 61 bits (147), Expect = 2e-008 Identities = 28/56 (50%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 141 LGRLKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKK-YGSWALVTG 305 + L TQP W+L + +G LS+ +S ++LNWV+ LR KNLK+ YGSWAL+TG Sbjct: 5 INHLTTQPLWLLIVSFLGFLSLFNYSFTLLNWVYKTVLRQPKNLKENYGSWALITG 60 >tr|B9RMQ9|B9RMQ9_RICCO Steroid dehydrogenase, putative OS=Ricinus communis GN=RCOM_1082630 PE=4 SV=1 Length = 342 Score = 60 bits (144), Expect = 4e-008 Identities = 28/56 (50%), Positives = 39/56 (69%), Gaps = 1/56 (1%) Frame = +3 Query: 141 LGRLKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKK-YGSWALVTG 305 + L TQP W+ + +G LS+L +S ++LNWV+ LR KNLK+ YGSWAL+TG Sbjct: 5 INHLTTQPLWLPIVSFLGFLSLLNYSFTLLNWVYKTVLRQPKNLKENYGSWALITG 60 >tr|B8LS27|B8LS27_PICSI Putative uncharacterized protein OS=Picea sitchensis PE=2 SV=1 Length = 324 Score = 60 bits (143), Expect = 5e-008 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = +3 Query: 171 VLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTGP 308 +L + ++G L+IL S +L W++V FLRP KNL KYGSWA+VTGP Sbjct: 21 LLFVGALGLLTILNTSSGLLKWIWVTFLRPGKNLSKYGSWAIVTGP 66 >tr|B3VXM4|B3VXM4_POPTN Short-chain dehydrogenase/reductase (Fragment) OS=Populus tremula PE=4 SV=1 Length = 147 Score = 57 bits (136), Expect = 3e-007 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 228 LNWVFVNFLRPAKNLKKYGSWALVTGP 308 L WV+V+FLRPAKNLKKYGSWALVTGP Sbjct: 2 LKWVYVSFLRPAKNLKKYGSWALVTGP 28 >tr|B3VXM6|B3VXM6_POPTN Short-chain dehydrogenase/reductase (Fragment) OS=Populus tremula PE=4 SV=1 Length = 147 Score = 57 bits (136), Expect = 3e-007 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 228 LNWVFVNFLRPAKNLKKYGSWALVTGP 308 L WV+V+FLRPAKNLKKYGSWALVTGP Sbjct: 2 LKWVYVSFLRPAKNLKKYGSWALVTGP 28 >tr|B3VXN0|B3VXN0_POPTN Short-chain dehydrogenase/reductase (Fragment) OS=Populus tremula PE=4 SV=1 Length = 147 Score = 57 bits (136), Expect = 3e-007 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 228 LNWVFVNFLRPAKNLKKYGSWALVTGP 308 L WV+V+FLRPAKNLKKYGSWALVTGP Sbjct: 2 LKWVYVSFLRPAKNLKKYGSWALVTGP 28 >tr|B3VXN1|B3VXN1_POPTN Short-chain dehydrogenase/reductase (Fragment) OS=Populus tremula PE=4 SV=1 Length = 147 Score = 57 bits (136), Expect = 3e-007 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 228 LNWVFVNFLRPAKNLKKYGSWALVTGP 308 L WV+V+FLRPAKNLKKYGSWALVTGP Sbjct: 2 LKWVYVSFLRPAKNLKKYGSWALVTGP 28 >tr|B3VXN4|B3VXN4_POPTN Short-chain dehydrogenase/reductase (Fragment) OS=Populus tremula PE=4 SV=1 Length = 147 Score = 57 bits (136), Expect = 3e-007 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 228 LNWVFVNFLRPAKNLKKYGSWALVTGP 308 L WV+V+FLRPAKNLKKYGSWALVTGP Sbjct: 2 LKWVYVSFLRPAKNLKKYGSWALVTGP 28 >tr|B3VXP7|B3VXP7_POPTN Short-chain dehydrogenase/reductase (Fragment) OS=Populus tremula PE=4 SV=1 Length = 147 Score = 57 bits (136), Expect = 3e-007 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 228 LNWVFVNFLRPAKNLKKYGSWALVTGP 308 L WV+V+FLRPAKNLKKYGSWALVTGP Sbjct: 2 LKWVYVSFLRPAKNLKKYGSWALVTGP 28 >tr|B3VXQ4|B3VXQ4_POPTN Short-chain dehydrogenase/reductase (Fragment) OS=Populus tremula PE=4 SV=1 Length = 147 Score = 57 bits (136), Expect = 3e-007 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +3 Query: 228 LNWVFVNFLRPAKNLKKYGSWALVTGP 308 L WV+V+FLRPAKNLKKYGSWALVTGP Sbjct: 2 LKWVYVSFLRPAKNLKKYGSWALVTGP 28 >tr|A7P443|A7P443_VITVI Chromosome chr1 scaffold_5, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00030690001 PE=3 SV=1 Length = 320 Score = 57 bits (135), Expect = 4e-007 Identities = 24/45 (53%), Positives = 36/45 (80%) Frame = +3 Query: 171 VLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTG 305 +LA+ ++G ++I + VSV+ WV++ FLRP +NLK YGSWA+VTG Sbjct: 8 LLAVSTLGFITIFKTLVSVVKWVWIMFLRPPRNLKDYGSWAVVTG 52 >tr|B3VYP4|B3VYP4_POPTN Short-chain dehydrogenase/reductase (Fragment) OS=Populus tremula PE=4 SV=1 Length = 130 Score = 55 bits (131), Expect = 1e-006 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +3 Query: 228 LNWVFVNFLRPAKNLKKYGSWALVTGP 308 L W +V+FLRPAKNLKKYGSWALVTGP Sbjct: 2 LKWFYVSFLRPAKNLKKYGSWALVTGP 28 >tr|B9RMR1|B9RMR1_RICCO Steroid dehydrogenase, putative OS=Ricinus communis GN=RCOM_1082850 PE=4 SV=1 Length = 324 Score = 55 bits (131), Expect = 1e-006 Identities = 25/53 (47%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = +3 Query: 150 LKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLK-KYGSWALVTG 305 ++ Q + +L + IG +S+++ + + LNWV+ FLRPAKNLK +YGSWA++TG Sbjct: 1 MELQDFILLTVSGIGFISLIKQTFTFLNWVWAMFLRPAKNLKQQYGSWAVITG 53 >tr|B3VYS2|B3VYS2_POPTN Short-chain dehydrogenase/reductase (Fragment) OS=Populus tremula PE=4 SV=1 Length = 130 Score = 55 bits (130), Expect = 2e-006 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = +3 Query: 228 LNWVFVNFLRPAKNLKKYGSWALVTGP 308 L W +V FLRPAKNLKKYGSWALVTGP Sbjct: 2 LKWFYVRFLRPAKNLKKYGSWALVTGP 28 >tr|O24479|O24479_HORVU B-keto acyl reductase OS=Hordeum vulgare GN=glossy8 PE=2 SV=1 Length = 325 Score = 54 bits (128), Expect = 3e-006 Identities = 25/53 (47%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = +3 Query: 150 LKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNL-KKYGSWALVTG 305 L+ QP W LAL ++G L R ++ + WV+ FLRP K+L ++YG WA+VTG Sbjct: 11 LRAQPAWALALAAVGLLVAARAALRLALWVYAAFLRPGKHLRRRYGPWAVVTG 63 >tr|A9RZJ1|A9RZJ1_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_105480 PE=3 SV=1 Length = 324 Score = 54 bits (127), Expect = 4e-006 Identities = 25/45 (55%), Positives = 32/45 (71%) Frame = +3 Query: 171 VLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNLKKYGSWALVTG 305 +L L +IG L ILRF ++ W + FLRPAKNL++YG W LVTG Sbjct: 20 LLVLAAIGFLFILRFVYLLVLWFYSYFLRPAKNLQRYGEWGLVTG 64 >tr|O24478|O24478_MAIZE Putative uncharacterized protein OS=Zea mays GN=glossy8 PE=2 SV=1 Length = 326 Score = 53 bits (126), Expect = 5e-006 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = +3 Query: 150 LKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNL-KKYGSWALVTG 305 L+ QP W LAL ++G L +R + WV+ FLRP K L ++YG+WA+VTG Sbjct: 11 LRAQPAWALALAAVGLLVAVRAAARFALWVYAAFLRPGKPLRRRYGAWAVVTG 63 >tr|Q8RUZ2|Q8RUZ2_MAIZE Beta-keto acyl reductase (Fragment) OS=Zea mays PE=4 SV=1 Length = 104 Score = 53 bits (126), Expect = 5e-006 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 1/53 (1%) Frame = +3 Query: 150 LKTQPWWVLALFSIGSLSILRFSVSVLNWVFVNFLRPAKNL-KKYGSWALVTG 305 L+ QP W LAL ++G L +R + WV+ FLRP K L ++YG+WA+VTG Sbjct: 11 LRAQPAWALALAAVGLLVAVRAAARFALWVYAAFLRPGKPLRRRYGAWAVVTG 63 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 309,246,347,612 Number of Sequences: 7695149 Number of Extensions: 309246347612 Number of Successful Extensions: 246574083 Number of sequences better than 0.0: 0 |