BLASTX 7.6.2 Query= RU21019 /QuerySize=208 (207 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9H2M1|B9H2M1_POPTR Glutamate-gated kainate-type ion channel ... 58 2e-007 tr|B9I1P7|B9I1P7_POPTR Glutamate-gated kainate-type ion channel ... 55 1e-006 tr|B9N9N2|B9N9N2_POPTR Glutamate-gated kainate-type ion channel ... 55 1e-006 >tr|B9H2M1|B9H2M1_POPTR Glutamate-gated kainate-type ion channel receptor subunit GluR5 OS=Populus trichocarpa GN=POPTRDRAFT_758817 PE=4 SV=1 Length = 942 Score = 58 bits (139), Expect = 2e-007 Identities = 25/48 (52%), Positives = 38/48 (79%) Frame = -3 Query: 205 KMRKLVTNVGAIVNLYSRMGKEQKTAMDVAAENFNIHSKTHSIILHFR 62 + KLVTN+GAI+++ SR+GKE+KTA+++A ++FN S H + LHFR Sbjct: 50 RTNKLVTNIGAIIDVNSRIGKEEKTALELAVQDFNDISTNHELSLHFR 97 >tr|B9I1P7|B9I1P7_POPTR Glutamate-gated kainate-type ion channel receptor subunit GluR5 OS=Populus trichocarpa GN=POPTRDRAFT_568753 PE=4 SV=1 Length = 838 Score = 55 bits (132), Expect = 1e-006 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -3 Query: 190 VTNVGAIVNLYSRMGKEQKTAMDVAAENFNIHSKTHSIILHFR 62 VTN+GAI++ SR GKE+KTAM++A +NFN S+ H + LHF+ Sbjct: 55 VTNIGAIIDGNSRSGKEEKTAMEIAVQNFNNISRNHKLSLHFK 97 >tr|B9N9N2|B9N9N2_POPTR Glutamate-gated kainate-type ion channel receptor subunit GluR5 OS=Populus trichocarpa GN=POPTRDRAFT_786926 PE=4 SV=1 Length = 407 Score = 55 bits (132), Expect = 1e-006 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -3 Query: 190 VTNVGAIVNLYSRMGKEQKTAMDVAAENFNIHSKTHSIILHFR 62 VTN+GAI++ SR GKE+KTAM++A +NFN S+ H + LHF+ Sbjct: 55 VTNIGAIIDGNSRTGKEEKTAMEIAVQNFNNISRNHKLSLHFK 97 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 344,827,939,568 Number of Sequences: 7695149 Number of Extensions: 344827939568 Number of Successful Extensions: 265040416 Number of sequences better than 0.0: 0 |