BLASTX 7.6.2 Query= RU22395 /QuerySize=369 (368 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B8AG27|B8AG27_ORYSI Putative uncharacterized protein OS=Oryza... 77 4e-013 tr|O23594|O23594_ARATH GTP-binding RAB1C like protein OS=Arabido... 74 2e-012 tr|A2WLD6|A2WLD6_ORYSI Putative uncharacterized protein OS=Oryza... 74 2e-012 tr|A7PBQ0|A7PBQ0_VITVI Chromosome chr16 scaffold_10, whole genom... 74 2e-012 tr|B4FC26|B4FC26_MAIZE Putative uncharacterized protein OS=Zea m... 74 2e-012 tr|B4FQY4|B4FQY4_MAIZE Putative uncharacterized protein OS=Zea m... 74 2e-012 tr|B7FH02|B7FH02_MEDTR Putative uncharacterized protein OS=Medic... 74 2e-012 tr|B9R9Z5|B9R9Z5_RICCO Putative uncharacterized protein OS=Ricin... 74 2e-012 tr|Q08153|Q08153_PEA GTP-binding protein OS=Pisum sativum PE=2 SV=1 74 2e-012 tr|Q0DZ18|Q0DZ18_ORYSJ Os02g0653800 protein OS=Oryza sativa subs... 74 2e-012 tr|Q0JQ62|Q0JQ62_ORYSJ Putative uncharacterized protein OS=Oryza... 74 2e-012 tr|Q2A998|Q2A998_BRAOL Ras-related GTP-binding protein, putative... 74 2e-012 tr|Q2A9H3|Q2A9H3_BRAOL GTP-binding protein, putative OS=Brassica... 74 2e-012 tr|Q2A9M1|Q2A9M1_BRAOL GTP-binding protein, putative OS=Brassica... 74 2e-012 tr|Q2A9V7|Q2A9V7_BRAOL GTP-binding protein, putative OS=Brassica... 74 2e-012 tr|Q40203|Q40203_LOTJA RAB1C OS=Lotus japonicus GN=rab1C PE=2 SV=1 74 2e-012 tr|Q41340|Q41340_SOLLC Small GTP-binding protein OS=Solanum lyco... 74 2e-012 tr|Q6H8G2|Q6H8G2_ORYSJ Putative uncharacterized protein OS=Oryza... 74 2e-012 tr|Q8W4S8|Q8W4S8_ARATH AT4g17530/dl4800c OS=Arabidopsis thaliana... 74 2e-012 tr|Q949E2|Q949E2_ORYSA Putative GTP-binding protein OS=Oryza sat... 74 2e-012 tr|Q9FPJ4|Q9FPJ4_ARATH AT5g47200 OS=Arabidopsis thaliana GN=AT5g... 74 2e-012 tr|Q9M7P5|Q9M7P5_CAPAN Small GTP-binding protein OS=Capsicum ann... 74 2e-012 tr|Q9SEH3|Q9SEH3_ARATH AT4g17530/dl4800c OS=Arabidopsis thaliana... 74 2e-012 tr|Q9SXT5|Q9SXT5_CICAR Rab-type small GTP-binding protein OS=Cic... 74 2e-012 tr|B7FK91|B7FK91_MEDTR Putative uncharacterized protein OS=Medic... 73 4e-012 tr|Q08155|Q08155_PEA GTP-binding protein OS=Pisum sativum PE=2 SV=1 73 4e-012 tr|Q7DLK9|Q7DLK9_VICFA Guanine nucleotide regulatory protein OS=... 73 4e-012 tr|B9MUT7|B9MUT7_POPTR Predicted protein OS=Populus trichocarpa ... 73 5e-012 tr|B9N0F8|B9N0F8_POPTR Predicted protein OS=Populus trichocarpa ... 73 5e-012 tr|B9SKB1|B9SKB1_RICCO Putative uncharacterized protein OS=Ricin... 73 5e-012 >tr|B8AG27|B8AG27_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_08312 PE=3 SV=1 Length = 206 Score = 77 bits (187), Expect = 4e-013 Identities = 42/63 (66%), Positives = 47/63 (74%), Gaps = 4/63 (6%) Frame = -1 Query: 209 CLSFC*SVILVSASHVYFCGLLM----ISYLDSYISTIGVDFKIRTVEQDGKTIKLQIWD 42 CL + ++L+ S V LL+ SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWD Sbjct: 7 CLDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWD 66 Query: 41 TAG 33 TAG Sbjct: 67 TAG 69 >tr|O23594|O23594_ARATH GTP-binding RAB1C like protein OS=Arabidopsis thaliana GN=dl4800c PE=3 SV=1 Length = 221 Score = 74 bits (181), Expect = 2e-012 Identities = 41/63 (65%), Positives = 46/63 (73%), Gaps = 4/63 (6%) Frame = -1 Query: 209 CLSFC*SVILVSASHVYFCGLLM----ISYLDSYISTIGVDFKIRTVEQDGKTIKLQIWD 42 C + ++L+ S V LL+ SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWD Sbjct: 23 CSDYLFKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIGVDFKIRTVEQDGKTIKLQIWD 82 Query: 41 TAG 33 TAG Sbjct: 83 TAG 85 >tr|A2WLD6|A2WLD6_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_00645 PE=3 SV=1 Length = 203 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|A7PBQ0|A7PBQ0_VITVI Chromosome chr16 scaffold_10, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00014195001 PE=3 SV=1 Length = 203 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|B4FC26|B4FC26_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1 Length = 203 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|B4FQY4|B4FQY4_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1 Length = 203 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|B7FH02|B7FH02_MEDTR Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1 Length = 202 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|B9R9Z5|B9R9Z5_RICCO Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1502390 PE=4 SV=1 Length = 203 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q08153|Q08153_PEA GTP-binding protein OS=Pisum sativum PE=2 SV=1 Length = 202 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q0DZ18|Q0DZ18_ORYSJ Os02g0653800 protein OS=Oryza sativa subsp. japonica GN=Os02g0653800 PE=3 SV=1 Length = 219 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 48 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 82 >tr|Q0JQ62|Q0JQ62_ORYSJ Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=Os01g0179700 PE=2 SV=1 Length = 203 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q2A998|Q2A998_BRAOL Ras-related GTP-binding protein, putative OS=Brassica oleracea GN=40.t00023 PE=3 SV=1 Length = 235 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 73 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 107 >tr|Q2A9H3|Q2A9H3_BRAOL GTP-binding protein, putative OS=Brassica oleracea GN=27.t00047 PE=3 SV=1 Length = 202 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q2A9M1|Q2A9M1_BRAOL GTP-binding protein, putative OS=Brassica oleracea GN=26.t00059 PE=3 SV=1 Length = 189 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 19 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 53 >tr|Q2A9V7|Q2A9V7_BRAOL GTP-binding protein, putative OS=Brassica oleracea GN=24.t00078 PE=3 SV=1 Length = 203 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q40203|Q40203_LOTJA RAB1C OS=Lotus japonicus GN=rab1C PE=2 SV=1 Length = 202 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q41340|Q41340_SOLLC Small GTP-binding protein OS=Solanum lycopersicum GN=LeRab1C PE=2 SV=1 Length = 203 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q6H8G2|Q6H8G2_ORYSJ Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=P0491E01.39 PE=2 SV=1 Length = 203 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q8W4S8|Q8W4S8_ARATH AT4g17530/dl4800c OS=Arabidopsis thaliana PE=2 SV=1 Length = 202 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q949E2|Q949E2_ORYSA Putative GTP-binding protein OS=Oryza sativa GN=W455ERIPDK PE=3 SV=1 Length = 203 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q9FPJ4|Q9FPJ4_ARATH AT5g47200 OS=Arabidopsis thaliana GN=AT5g47200/MQL5_5 PE=2 SV=1 Length = 202 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q9M7P5|Q9M7P5_CAPAN Small GTP-binding protein OS=Capsicum annuum PE=2 SV=1 Length = 203 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q9SEH3|Q9SEH3_ARATH AT4g17530/dl4800c OS=Arabidopsis thaliana GN=RAB1c PE=2 SV=1 Length = 202 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q9SXT5|Q9SXT5_CICAR Rab-type small GTP-binding protein OS=Cicer arietinum PE=2 SV=1 Length = 202 Score = 74 bits (180), Expect = 2e-012 Identities = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|B7FK91|B7FK91_MEDTR Putative uncharacterized protein OS=Medicago truncatula PE=2 SV=1 Length = 207 Score = 73 bits (178), Expect = 4e-012 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SY+DSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYIDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q08155|Q08155_PEA GTP-binding protein OS=Pisum sativum PE=2 SV=1 Length = 202 Score = 73 bits (178), Expect = 4e-012 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SY+DSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYIDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|Q7DLK9|Q7DLK9_VICFA Guanine nucleotide regulatory protein OS=Vicia faba PE=2 SV=1 Length = 202 Score = 73 bits (178), Expect = 4e-012 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SY+DSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYIDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|B9MUT7|B9MUT7_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_676434 PE=4 SV=1 Length = 203 Score = 73 bits (177), Expect = 5e-012 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SYLDSYISTIGVDFKIRTVEQDGKT+KLQIWDTAG Sbjct: 32 SYLDSYISTIGVDFKIRTVEQDGKTMKLQIWDTAG 66 >tr|B9N0F8|B9N0F8_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_742527 PE=4 SV=1 Length = 201 Score = 73 bits (177), Expect = 5e-012 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SY+DSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYVDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 >tr|B9SKB1|B9SKB1_RICCO Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0757650 PE=4 SV=1 Length = 202 Score = 73 bits (177), Expect = 5e-012 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = -1 Query: 137 SYLDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 33 SY+DSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG Sbjct: 32 SYVDSYISTIGVDFKIRTVEQDGKTIKLQIWDTAG 66 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 354,968,454,564 Number of Sequences: 7695149 Number of Extensions: 354968454564 Number of Successful Extensions: 282432510 Number of sequences better than 0.0: 0 |