BLASTX 7.6.2 Query= RU23458 /QuerySize=297 (296 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|Q5NDZ2|Q5NDZ2_PRUAV Putative auxin influx carrier protein OS=... 53 6e-006 >tr|Q5NDZ2|Q5NDZ2_PRUAV Putative auxin influx carrier protein OS=Prunus avium GN=lax1 PE=2 SV=1 Length = 483 Score = 53 bits (125), Expect = 6e-006 Identities = 28/40 (70%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = +2 Query: 140 MLPQKQAEEAIVSNFSEGADHEGKELGAEENKDGENASLF 259 ML QKQAEEAIVSNFSE DHEGKE ++K+ EN SLF Sbjct: 1 MLAQKQAEEAIVSNFSEAHDHEGKE-DHHQDKEEENTSLF 39 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 375,280,056,884 Number of Sequences: 7695149 Number of Extensions: 375280056884 Number of Successful Extensions: 316892680 Number of sequences better than 0.0: 0 |