BLASTX 7.6.2 Query= RU24845 /QuerySize=349 (348 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B3H6A8|B3H6A8_ARATH Uncharacterized protein At5g45428.1 OS=Ar... 64 3e-009 tr|B3H7F4|B3H7F4_ARATH Uncharacterized protein At4g19112.1 OS=Ar... 63 5e-009 >tr|B3H6A8|B3H6A8_ARATH Uncharacterized protein At5g45428.1 OS=Arabidopsis thaliana GN=At5g45428 PE=4 SV=1 Length = 41 Score = 64 bits (153), Expect = 3e-009 Identities = 29/41 (70%), Positives = 32/41 (78%) Frame = -2 Query: 140 MEQVRLLSNCHQYRVFSFQEVLDWRFLVLGDFLLVSFVNCT 18 MEQ + S C+QYRVFS QE LDWRFLV DFL+ SFVNCT Sbjct: 1 MEQDYICSGCYQYRVFSLQEALDWRFLVHSDFLIGSFVNCT 41 >tr|B3H7F4|B3H7F4_ARATH Uncharacterized protein At4g19112.1 OS=Arabidopsis thaliana GN=At4g19112 PE=4 SV=1 Length = 41 Score = 63 bits (151), Expect = 5e-009 Identities = 28/41 (68%), Positives = 33/41 (80%) Frame = -2 Query: 140 MEQVRLLSNCHQYRVFSFQEVLDWRFLVLGDFLLVSFVNCT 18 MEQV + +C+ YR+FSFQE LDWRFLV DFL+ SFVNCT Sbjct: 1 MEQVFVWPSCYHYRLFSFQEALDWRFLVRSDFLVGSFVNCT 41 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 421,013,289,258 Number of Sequences: 7695149 Number of Extensions: 421013289258 Number of Successful Extensions: 354103940 Number of sequences better than 0.0: 0 |