BLASTX 7.6.2 Query= RU24897 /QuerySize=389 (388 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|A9PG59|A9PG59_POPTR Putative uncharacterized protein OS=Popul... 55 1e-006 tr|B9IKA6|B9IKA6_POPTR Predicted protein OS=Populus trichocarpa ... 55 1e-006 >tr|A9PG59|A9PG59_POPTR Putative uncharacterized protein OS=Populus trichocarpa PE=2 SV=1 Length = 315 Score = 55 bits (131), Expect = 1e-006 Identities = 28/60 (46%), Positives = 36/60 (60%), Gaps = 2/60 (3%) Frame = +1 Query: 154 VYSQLHLQDHHVSRTKSDTKPASGDLPXXXXXXXXXXXXXXXXXXHFEADDIVESRRPAT 333 +YS+ LQ + +S++KSDTKP SG++P HFE DDIVESRRPAT Sbjct: 209 IYSK--LQGNKLSKSKSDTKPTSGEVPKKLPKKMKKSASAKSAFAHFEEDDIVESRRPAT 266 >tr|B9IKA6|B9IKA6_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_577950 PE=4 SV=1 Length = 315 Score = 55 bits (131), Expect = 1e-006 Identities = 28/60 (46%), Positives = 36/60 (60%), Gaps = 2/60 (3%) Frame = +1 Query: 154 VYSQLHLQDHHVSRTKSDTKPASGDLPXXXXXXXXXXXXXXXXXXHFEADDIVESRRPAT 333 +YS+ LQ + +S++KSDTKP SG++P HFE DDIVESRRPAT Sbjct: 209 IYSK--LQGNKLSKSKSDTKPTSGEVPKKLPKKMKKSASAKSAFAHFEEDDIVESRRPAT 266 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 421,013,289,258 Number of Sequences: 7695149 Number of Extensions: 421013289258 Number of Successful Extensions: 354103940 Number of sequences better than 0.0: 0 |