BLASTX 7.6.2 Query= RU26027 /QuerySize=404 (403 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9H8Y3|B9H8Y3_POPTR Predicted protein OS=Populus trichocarpa ... 62 9e-009 tr|A5BCJ0|A5BCJ0_VITVI Chromosome chr4 scaffold_6, whole genome ... 60 3e-008 tr|A7P754|A7P754_VITVI Chromosome chr9 scaffold_7, whole genome ... 57 4e-007 tr|B9IKH6|B9IKH6_POPTR Predicted protein (Fragment) OS=Populus t... 54 3e-006 tr|B9NEK3|B9NEK3_POPTR Predicted protein OS=Populus trichocarpa ... 54 3e-006 tr|B9RQG2|B9RQG2_RICCO GATA transcription factor, putative OS=Ri... 52 9e-006 >tr|B9H8Y3|B9H8Y3_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_802380 PE=4 SV=1 Length = 357 Score = 62 bits (149), Expect = 9e-009 Identities = 34/50 (68%), Positives = 40/50 (80%), Gaps = 5/50 (10%) Frame = -1 Query: 163 MAALEFLGG----AFSSEDLQKLQLISGMKARPDEAASETRHFQPDPNNH 26 +A LE+L +FSSEDLQ+LQLISGMKARPDE +SETRHFQ D NN+ Sbjct: 109 LAELEWLSNFVEESFSSEDLQRLQLISGMKARPDE-SSETRHFQSDDNNN 157 >tr|A5BCJ0|A5BCJ0_VITVI Chromosome chr4 scaffold_6, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00032414001 PE=4 SV=1 Length = 342 Score = 60 bits (145), Expect = 3e-008 Identities = 29/43 (67%), Positives = 32/43 (74%), Gaps = 1/43 (2%) Frame = -2 Query: 258 PIFPADFGSRNFNEVPFSSDLCVPYDDLAELEWQLSSFSEERF 130 P F D GSRN+ + FSSDLCVPYDDLAELEW LS+ EE F Sbjct: 83 PQFAGDIGSRNYTDAHFSSDLCVPYDDLAELEW-LSNIVEESF 124 Score = 52 bits (123), Expect = 9e-006 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 5/50 (10%) Frame = -1 Query: 163 MAALEFLGG----AFSSEDLQKLQLISGMKARPDEAASETRHFQPDPNNH 26 +A LE+L +FSSEDL+KLQLISGMKA +E ASETR FQP+ N + Sbjct: 110 LAELEWLSNIVEESFSSEDLEKLQLISGMKANTEE-ASETRDFQPENNQN 158 >tr|A7P754|A7P754_VITVI Chromosome chr9 scaffold_7, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00034329001 PE=4 SV=1 Length = 329 Score = 57 bits (135), Expect = 4e-007 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 1/47 (2%) Frame = -2 Query: 270 AANRPIFPADFGSRNFNEVPFSSDLCVPYDDLAELEWQLSSFSEERF 130 + N P F D G RNF + FS +LCVP D+LAELEW LS+F EE F Sbjct: 76 SGNEPHFSGDVGCRNFTDAQFSGELCVPCDELAELEW-LSNFVEESF 121 >tr|B9IKH6|B9IKH6_POPTR Predicted protein (Fragment) OS=Populus trichocarpa GN=POPTRDRAFT_260610 PE=4 SV=1 Length = 320 Score = 54 bits (127), Expect = 3e-006 Identities = 33/59 (55%), Positives = 42/59 (71%), Gaps = 10/59 (16%) Frame = -1 Query: 163 MAALEFLGG----AFSSEDLQKLQLISGMKARPDEAASETRHFQ-----PDPNNHIISN 14 +A LE+L +FSSEDLQ+LQLISGMKARPDE +S++RHF+ D NN +SN Sbjct: 67 LAELEWLSNFVEESFSSEDLQRLQLISGMKARPDE-SSKSRHFRTHGDTDDNNNGDVSN 124 >tr|B9NEK3|B9NEK3_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_789604 PE=4 SV=1 Length = 264 Score = 54 bits (127), Expect = 3e-006 Identities = 33/59 (55%), Positives = 42/59 (71%), Gaps = 10/59 (16%) Frame = -1 Query: 163 MAALEFLGG----AFSSEDLQKLQLISGMKARPDEAASETRHFQ-----PDPNNHIISN 14 +A LE+L +FSSEDLQ+LQLISGMKARPDE +S++RHF+ D NN +SN Sbjct: 11 LAELEWLSNFVEESFSSEDLQRLQLISGMKARPDE-SSKSRHFRTHGDTDDNNNGDVSN 68 >tr|B9RQG2|B9RQG2_RICCO GATA transcription factor, putative OS=Ricinus communis GN=RCOM_1491210 PE=4 SV=1 Length = 338 Score = 52 bits (123), Expect = 9e-006 Identities = 26/58 (44%), Positives = 38/58 (65%), Gaps = 1/58 (1%) Frame = -2 Query: 270 AANRPIFPADFGSRNFNEVPFSSDLCVPYDDLAELEWQLSSFSEERFPARTSRSCSSY 97 ++N I FG ++F + FSS+LCVPYDDLAELEW LS+F E+ F + +++ Sbjct: 87 SSNSSISGKHFGYQSFADSYFSSELCVPYDDLAELEW-LSNFVEDSFSTEQNLQVNNF 143 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 426,067,680,016 Number of Sequences: 7695149 Number of Extensions: 426067680016 Number of Successful Extensions: 362663940 Number of sequences better than 0.0: 0 |