BLASTX 7.6.2 Query= RU26964 /QuerySize=309 (308 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B4FU27|B4FU27_MAIZE Putative uncharacterized protein OS=Zea m... 52 8e-006 >tr|B4FU27|B4FU27_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1 Length = 362 Score = 52 bits (124), Expect = 8e-006 Identities = 25/48 (52%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = -2 Query: 151 MDVKPGRVSDTIRNSS-EEDEDAMMMDLRRGPWTVEEDVALMNYIANH 11 M + G ++ + S ED++AMM++LRRGPWT+EED LMNYIA H Sbjct: 1 MSQRKGAMAAAVTASKHREDQEAMMVELRRGPWTLEEDNLLMNYIACH 48 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 466,234,369,300 Number of Sequences: 7695149 Number of Extensions: 466234369300 Number of Successful Extensions: 392373305 Number of sequences better than 0.0: 0 |