BLASTX 7.6.2 Query= RU27821 /QuerySize=616 (615 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|A5BB89|A5BB89_VITVI Putative uncharacterized protein OS=Vitis... 76 2e-012 >tr|A5BB89|A5BB89_VITVI Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_036268 PE=4 SV=1 Length = 274 Score = 76 bits (185), Expect = 2e-012 Identities = 32/51 (62%), Positives = 44/51 (86%) Frame = +3 Query: 462 KWLCGQMRRDQDIDNRSTEDKSGMNMFGSDEEIGTQIPTQAQSVVEGS.AV 614 KWLCG MRRDQD+D+ ++ +G++MFGSD+E+ TQ+PTQAQSVVEGS ++ Sbjct: 57 KWLCGYMRRDQDMDSSRNDEVNGVHMFGSDDEVFTQVPTQAQSVVEGSGSL 107 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 466,234,369,300 Number of Sequences: 7695149 Number of Extensions: 466234369300 Number of Successful Extensions: 392373305 Number of sequences better than 0.0: 0 |