BLASTX 7.6.2 Query= RU29857 /QuerySize=192 (191 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9RLL9|B9RLL9_RICCO Putative uncharacterized protein OS=Ricin... 62 1e-008 >tr|B9RLL9|B9RLL9_RICCO Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1469330 PE=4 SV=1 Length = 1566 Score = 62 bits (148), Expect = 1e-008 Identities = 26/56 (46%), Positives = 39/56 (69%) Frame = +1 Query: 16 FDFHRGRCFRGASCRYMHRAHDQSDGSWRHRSNQKHLEVQPSVKNSRIKEEIEDSS 183 FDF RG+C+RGASCRY+H +++DGS H+S Q +++ PS KN ++ + SS Sbjct: 708 FDFLRGKCYRGASCRYLHHDSEKNDGSRHHKSKQHVVQLPPSSKNVNTHDDSKKSS 763 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 495,117,016,431 Number of Sequences: 7695149 Number of Extensions: 495117016431 Number of Successful Extensions: 407100990 Number of sequences better than 0.0: 0 |