BLASTX 7.6.2 Query= RU33428 /QuerySize=160 (159 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|Q3ZUV1|Q3ZUV1_ROSHC Putative TIR-NBS-LRR resistance protein (... 71 3e-011 tr|A7PQ08|A7PQ08_VITVI Chromosome chr18 scaffold_24, whole genom... 53 6e-006 >tr|Q3ZUV1|Q3ZUV1_ROSHC Putative TIR-NBS-LRR resistance protein (Fragment) OS=Rosa hybrid cultivar GN=brp18 PE=4 SV=1 Length = 213 Score = 71 bits (172), Expect = 3e-011 Identities = 35/51 (68%), Positives = 40/51 (78%) Frame = -3 Query: 157 ASKLFNLSAFKGSICPDDFTELVTEVRHYAKGIPLVLEVLGSDLCGKDKDE 5 A +LFN +AFKG+I DDF +L T V YAKGIPL LEVLGSDLC K+KDE Sbjct: 128 ALELFNFNAFKGNIHMDDFFDLATGVIRYAKGIPLALEVLGSDLCSKNKDE 178 >tr|A7PQ08|A7PQ08_VITVI Chromosome chr18 scaffold_24, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00021866001 PE=4 SV=1 Length = 557 Score = 53 bits (126), Expect = 6e-006 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = -3 Query: 157 ASKLFNLSAFKGSICPDDFTELVTEVRHYAKGIPLVLEVLGSDLCGKDKDE 5 A+KLFN AF+ D EL+ V YA+G+PL L+VLGS LC K KDE Sbjct: 355 ATKLFNHYAFRNDTPSRDVIELIDHVIAYAQGLPLALKVLGSSLCKKSKDE 405 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 519,431,597,725 Number of Sequences: 7695149 Number of Extensions: 519431597725 Number of Successful Extensions: 439049758 Number of sequences better than 0.0: 0 |