BLASTX 7.6.2 Query= RU33526 /QuerySize=186 (185 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|A5ALS5|A5ALS5_VITVI Putative uncharacterized protein OS=Vitis... 52 9e-006 tr|A7PHG6|A7PHG6_VITVI Chromosome chr17 scaffold_16, whole genom... 52 9e-006 >tr|A5ALS5|A5ALS5_VITVI Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_028712 PE=4 SV=1 Length = 217 Score = 52 bits (124), Expect = 9e-006 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 114 QPSDSNQAASGASISLQNLPSRGLFSAPVLSLNPGRMR 1 QPS+SNQ AS AS L NLPSRGLFS+ V+S NPG MR Sbjct: 7 QPSNSNQTASEASKYLVNLPSRGLFSSTVISSNPGGMR 44 >tr|A7PHG6|A7PHG6_VITVI Chromosome chr17 scaffold_16, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00017933001 PE=4 SV=1 Length = 172 Score = 52 bits (124), Expect = 9e-006 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -3 Query: 114 QPSDSNQAASGASISLQNLPSRGLFSAPVLSLNPGRMR 1 QPS+SNQ AS AS L NLPSRGLFS+ V+S NPG MR Sbjct: 7 QPSNSNQTASEASKYLVNLPSRGLFSSTVISSNPGGMR 44 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 519,431,597,725 Number of Sequences: 7695149 Number of Extensions: 519431597725 Number of Successful Extensions: 439049758 Number of sequences better than 0.0: 0 |