BLASTX 7.6.2 Query= RU35769 /QuerySize=260 (259 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9I3L4|B9I3L4_POPTR Predicted protein OS=Populus trichocarpa ... 56 8e-007 >tr|B9I3L4|B9I3L4_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_570206 PE=4 SV=1 Length = 289 Score = 56 bits (133), Expect = 8e-007 Identities = 25/56 (44%), Positives = 37/56 (66%) Frame = +3 Query: 87 ELFLKIHEDCGGKLQYLVLMVPGPFQQGWNAFALDHDLQVGDFLVFNYVVGSHFTV 254 E FL+ K++ +L Q+GW+AFA DH L++GDF++FNY++GSHF V Sbjct: 62 ETFLEDSSGQRWKVKVSILNDSFVLQEGWSAFASDHGLELGDFIIFNYIMGSHFEV 117 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 534,008,580,151 Number of Sequences: 7695149 Number of Extensions: 534008580151 Number of Successful Extensions: 439546097 Number of sequences better than 0.0: 0 |