BLASTX 7.6.2 Query= RU36459 /QuerySize=273 (272 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9SIH1|B9SIH1_RICCO Putative uncharacterized protein OS=Ricin... 67 2e-010 tr|O81837|O81837_ARATH Putative uncharacterized protein AT4g2734... 67 3e-010 tr|Q6NQ64|Q6NQ64_ARATH At4g27340 OS=Arabidopsis thaliana GN=At4g... 67 3e-010 tr|A2Q1F9|A2Q1F9_MEDTR SAM binding motif, putative OS=Medicago t... 64 2e-009 >tr|B9SIH1|B9SIH1_RICCO Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1256170 PE=4 SV=1 Length = 641 Score = 67 bits (163), Expect = 2e-010 Identities = 30/46 (65%), Positives = 40/46 (86%) Frame = +2 Query: 26 GKSDGDGEPLSAVLYREKLAKTFDSRGYVNFRNLAKMSRPNQKKRR 163 G+++GDGE LS VLYRE+LAK F+SRG+ FRNLAK+SRP ++KR+ Sbjct: 201 GRAEGDGEELSPVLYRERLAKEFNSRGFFKFRNLAKISRPPKRKRK 246 >tr|O81837|O81837_ARATH Putative uncharacterized protein AT4g27340 OS=Arabidopsis thaliana GN=AT4g27340 PE=2 SV=1 Length = 562 Score = 67 bits (162), Expect = 3e-010 Identities = 29/45 (64%), Positives = 41/45 (91%) Frame = +2 Query: 26 GKSDGDGEPLSAVLYREKLAKTFDSRGYVNFRNLAKMSRPNQKKR 160 GK++GDGE LS+VL+R+KLA+TF+S GY+ FRNLAK+SRP +K++ Sbjct: 177 GKAEGDGERLSSVLHRDKLARTFNSTGYLKFRNLAKISRPKRKRK 221 >tr|Q6NQ64|Q6NQ64_ARATH At4g27340 OS=Arabidopsis thaliana GN=At4g27340 PE=2 SV=1 Length = 619 Score = 67 bits (162), Expect = 3e-010 Identities = 29/45 (64%), Positives = 41/45 (91%) Frame = +2 Query: 26 GKSDGDGEPLSAVLYREKLAKTFDSRGYVNFRNLAKMSRPNQKKR 160 GK++GDGE LS+VL+R+KLA+TF+S GY+ FRNLAK+SRP +K++ Sbjct: 177 GKAEGDGERLSSVLHRDKLARTFNSTGYLKFRNLAKISRPKRKRK 221 >tr|A2Q1F9|A2Q1F9_MEDTR SAM binding motif, putative OS=Medicago truncatula GN=MtrDRAFT_AC148815g26v2 PE=4 SV=1 Length = 262 Score = 64 bits (155), Expect = 2e-009 Identities = 28/45 (62%), Positives = 38/45 (84%) Frame = +2 Query: 29 KSDGDGEPLSAVLYREKLAKTFDSRGYVNFRNLAKMSRPNQKKRR 163 + DGD + LS VLYR+KLAKTF++RG+V FRNLAK+SRPN+ ++ Sbjct: 141 EGDGDDDALSPVLYRDKLAKTFNTRGFVKFRNLAKISRPNRNNKK 185 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 538,896,710,479 Number of Sequences: 7695149 Number of Extensions: 538896710479 Number of Successful Extensions: 448454465 Number of sequences better than 0.0: 0 |