BLASTX 7.6.2 Query= RU37617 /QuerySize=241 (240 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|A5BKN4|A5BKN4_VITVI Putative uncharacterized protein OS=Vitis... 58 2e-007 tr|A2Y9Q4|A2Y9Q4_ORYSI Putative uncharacterized protein OS=Oryza... 57 3e-007 tr|A7NTY9|A7NTY9_VITVI Chromosome chr18 scaffold_1, whole genome... 57 3e-007 tr|A7PLB8|A7PLB8_VITVI Chromosome chr7 scaffold_20, whole genome... 57 3e-007 tr|B4FE22|B4FE22_MAIZE Putative uncharacterized protein OS=Zea m... 57 3e-007 tr|B9MVT5|B9MVT5_POPTR Predicted protein OS=Populus trichocarpa ... 57 3e-007 tr|B9R797|B9R797_RICCO Putative uncharacterized protein OS=Ricin... 57 3e-007 tr|B9SC94|B9SC94_RICCO Putative uncharacterized protein OS=Ricin... 57 3e-007 tr|Q5ULY0|Q5ULY0_FRAAN Basic helix-loop-helix protein (Fragment)... 57 3e-007 tr|Q5VRS4|Q5VRS4_ORYSJ Putative uncharacterized protein OS=Oryza... 57 3e-007 tr|Q680B1|Q680B1_ARATH Putative bHLH transcription factor (BHLH0... 57 3e-007 tr|Q8LFU9|Q8LFU9_ARATH Putative uncharacterized protein OS=Arabi... 57 3e-007 tr|A9NSU4|A9NSU4_PICSI Putative uncharacterized protein OS=Picea... 56 8e-007 tr|A2XAR2|A2XAR2_ORYSI Putative uncharacterized protein OS=Oryza... 54 2e-006 tr|A3ACF9|A3ACF9_ORYSJ Putative uncharacterized protein OS=Oryza... 54 2e-006 tr|A9SDX1|A9SDX1_PHYPA Predicted protein OS=Physcomitrella paten... 54 2e-006 tr|A9SJ30|A9SJ30_PHYPA Predicted protein (Fragment) OS=Physcomit... 54 2e-006 tr|Q6K844|Q6K844_ORYSJ Putative uncharacterized protein OJ1548_F... 54 2e-006 tr|Q948F6|Q948F6_ORYSA Putative SPATULA OS=Oryza sativa GN=OSJNB... 54 2e-006 tr|C0JP14|C0JP14_LOTJA Putative basic helix-loop-helix protein B... 54 3e-006 tr|A9T0S9|A9T0S9_PHYPA Predicted protein (Fragment) OS=Physcomit... 53 7e-006 tr|B9H6H4|B9H6H4_POPTR Predicted protein OS=Populus trichocarpa ... 53 7e-006 tr|B4F8E4|B4F8E4_MAIZE Putative uncharacterized protein OS=Zea m... 52 9e-006 tr|B4FIY1|B4FIY1_MAIZE Putative uncharacterized protein OS=Zea m... 52 9e-006 tr|B6TQ92|B6TQ92_MAIZE Putative uncharacterized protein OS=Zea m... 52 9e-006 >tr|A5BKN4|A5BKN4_VITVI Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_042277 PE=4 SV=1 Length = 489 Score = 58 bits (138), Expect = 2e-007 Identities = 29/31 (93%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQRGE 195 IPNSNKTDKASMLDEAIEYLKQLQLQVQ E Sbjct: 207 IPNSNKTDKASMLDEAIEYLKQLQLQVQNLE 237 >tr|A2Y9Q4|A2Y9Q4_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_21804 PE=4 SV=1 Length = 315 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 130 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 157 >tr|A7NTY9|A7NTY9_VITVI Chromosome chr18 scaffold_1, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00014850001 PE=4 SV=1 Length = 344 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 214 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 241 >tr|A7PLB8|A7PLB8_VITVI Chromosome chr7 scaffold_20, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00019511001 PE=4 SV=1 Length = 214 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 56 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 83 >tr|B4FE22|B4FE22_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1 Length = 312 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 132 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 159 >tr|B9MVT5|B9MVT5_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_591980 PE=4 SV=1 Length = 310 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 150 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 177 >tr|B9R797|B9R797_RICCO Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1589670 PE=4 SV=1 Length = 312 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 152 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 179 >tr|B9SC94|B9SC94_RICCO Putative uncharacterized protein OS=Ricinus communis GN=RCOM_1409990 PE=4 SV=1 Length = 406 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 188 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 215 >tr|Q5ULY0|Q5ULY0_FRAAN Basic helix-loop-helix protein (Fragment) OS=Fragaria ananassa PE=2 SV=1 Length = 298 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 171 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 198 >tr|Q5VRS4|Q5VRS4_ORYSJ Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OSJNBa0015I14.14 PE=4 SV=1 Length = 315 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 130 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 157 >tr|Q680B1|Q680B1_ARATH Putative bHLH transcription factor (BHLH073/ALCATRAZ) OS=Arabidopsis thaliana GN=At5g67111 PE=2 SV=1 Length = 210 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 120 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 147 >tr|Q8LFU9|Q8LFU9_ARATH Putative uncharacterized protein OS=Arabidopsis thaliana PE=2 SV=1 Length = 210 Score = 57 bits (137), Expect = 3e-007 Identities = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLKQLQLQVQ Sbjct: 120 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 147 >tr|A9NSU4|A9NSU4_PICSI Putative uncharacterized protein OS=Picea sitchensis PE=2 SV=1 Length = 333 Score = 56 bits (133), Expect = 8e-007 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLK+LQLQVQ Sbjct: 183 IPNSNKTDKASMLDEAIEYLKKLQLQVQ 210 >tr|A2XAR2|A2XAR2_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica GN=OsI_09345 PE=4 SV=1 Length = 320 Score = 54 bits (129), Expect = 2e-006 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNS+KTDKASMLD+AIEYLKQLQLQVQ Sbjct: 81 IPNSSKTDKASMLDDAIEYLKQLQLQVQ 108 >tr|A3ACF9|A3ACF9_ORYSJ Putative uncharacterized protein OS=Oryza sativa subsp. japonica GN=OsJ_08778 PE=4 SV=1 Length = 320 Score = 54 bits (129), Expect = 2e-006 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNS+KTDKASMLD+AIEYLKQLQLQVQ Sbjct: 81 IPNSSKTDKASMLDDAIEYLKQLQLQVQ 108 >tr|A9SDX1|A9SDX1_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_164436 PE=4 SV=1 Length = 801 Score = 54 bits (129), Expect = 2e-006 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLK LQLQ+Q Sbjct: 622 IPNSNKTDKASMLDEAIEYLKMLQLQLQ 649 >tr|A9SJ30|A9SJ30_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_130842 PE=4 SV=1 Length = 81 Score = 54 bits (129), Expect = 2e-006 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASMLDEAIEYLK LQLQ+Q Sbjct: 50 IPNSNKTDKASMLDEAIEYLKMLQLQLQ 77 >tr|Q6K844|Q6K844_ORYSJ Putative uncharacterized protein OJ1548_F12.19 OS=Oryza sativa subsp. japonica GN=OJ1548_F12.19 PE=4 SV=1 Length = 110 Score = 54 bits (129), Expect = 2e-006 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNS+KTDKASMLD+AIEYLKQLQLQVQ Sbjct: 59 IPNSSKTDKASMLDDAIEYLKQLQLQVQ 86 >tr|Q948F6|Q948F6_ORYSA Putative SPATULA OS=Oryza sativa GN=OSJNBa0049O12.18 PE=4 SV=1 Length = 298 Score = 54 bits (129), Expect = 2e-006 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNS+KTDKASMLD+AIEYLKQLQLQVQ Sbjct: 59 IPNSSKTDKASMLDDAIEYLKQLQLQVQ 86 >tr|C0JP14|C0JP14_LOTJA Putative basic helix-loop-helix protein BHLH9 OS=Lotus japonicus PE=4 SV=1 Length = 165 Score = 54 bits (128), Expect = 3e-006 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKA MLDEAI+YLKQLQLQVQ Sbjct: 102 IPNSNKTDKAFMLDEAIDYLKQLQLQVQ 129 >tr|A9T0S9|A9T0S9_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens GN=PHYPADRAFT_49637 PE=4 SV=1 Length = 78 Score = 53 bits (125), Expect = 7e-006 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNSNKTDKASML+EAIEYLK LQLQ+Q Sbjct: 50 IPNSNKTDKASMLEEAIEYLKMLQLQLQ 77 >tr|B9H6H4|B9H6H4_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_760479 PE=4 SV=1 Length = 220 Score = 53 bits (125), Expect = 7e-006 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNS+KTDKASMLDEAIEYLK LQLQVQ Sbjct: 165 IPNSSKTDKASMLDEAIEYLKLLQLQVQ 192 >tr|B4F8E4|B4F8E4_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1 Length = 280 Score = 52 bits (124), Expect = 9e-006 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNS+KTDKASMLD+AIEYLK LQLQVQ Sbjct: 72 IPNSSKTDKASMLDDAIEYLKHLQLQVQ 99 >tr|B4FIY1|B4FIY1_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1 Length = 216 Score = 52 bits (124), Expect = 9e-006 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNS+KTDKASMLD+AIEYLK LQLQVQ Sbjct: 8 IPNSSKTDKASMLDDAIEYLKHLQLQVQ 35 >tr|B6TQ92|B6TQ92_MAIZE Putative uncharacterized protein OS=Zea mays PE=2 SV=1 Length = 282 Score = 52 bits (124), Expect = 9e-006 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = +1 Query: 103 IPNSNKTDKASMLDEAIEYLKQLQLQVQ 186 IPNS+KTDKASMLD+AIEYLK LQLQVQ Sbjct: 74 IPNSSKTDKASMLDDAIEYLKHLQLQVQ 101 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 543,837,956,035 Number of Sequences: 7695149 Number of Extensions: 543837956035 Number of Successful Extensions: 461012303 Number of sequences better than 0.0: 0 |