BLASTX 7.6.2 Query= RU41840 /QuerySize=229 (228 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9HDU0|B9HDU0_POPTR Predicted protein OS=Populus trichocarpa ... 57 4e-007 tr|B9IHK5|B9IHK5_POPTR Predicted protein OS=Populus trichocarpa ... 55 2e-006 >tr|B9HDU0|B9HDU0_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_652520 PE=4 SV=1 Length = 260 Score = 57 bits (136), Expect = 4e-007 Identities = 26/37 (70%), Positives = 28/37 (75%) Frame = +1 Query: 7 SLPTVVKPEPQRPGGNRLPGGGCLPTLDTSALLFDHH 117 S+ V+KPEPQRPGG L G G LPTLDTSA L DHH Sbjct: 162 SMVPVLKPEPQRPGGRLLVGSGYLPTLDTSAFLLDHH 198 >tr|B9IHK5|B9IHK5_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_576097 PE=4 SV=1 Length = 255 Score = 55 bits (130), Expect = 2e-006 Identities = 25/37 (67%), Positives = 27/37 (72%) Frame = +1 Query: 7 SLPTVVKPEPQRPGGNRLPGGGCLPTLDTSALLFDHH 117 S+ V+KPEPQR GG G GCLPTLDTSA L DHH Sbjct: 164 SMVPVLKPEPQRLGGRFQGGSGCLPTLDTSAFLLDHH 200 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 573,089,819,551 Number of Sequences: 7695149 Number of Extensions: 573089819551 Number of Successful Extensions: 474773279 Number of sequences better than 0.0: 0 |