BLASTX 7.6.2 Query= RU45054 /QuerySize=406 (405 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9HMC3|B9HMC3_POPTR Predicted protein OS=Populus trichocarpa ... 55 1e-006 tr|A7NWE6|A7NWE6_VITVI Chromosome chr5 scaffold_2, whole genome ... 52 7e-006 tr|B9RSS1|B9RSS1_RICCO Ribonucleoside-diphosphate reductase smal... 52 7e-006 >tr|B9HMC3|B9HMC3_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_872567 PE=4 SV=1 Length = 342 Score = 55 bits (130), Expect = 1e-006 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +3 Query: 285 FASSEEVDLSQDVQLWEALIDSKKHFISHVLAF 383 F ++EEVDLS+D+Q WEAL DS+KHFISHVLAF Sbjct: 51 FWTAEEVDLSRDMQQWEALSDSEKHFISHVLAF 83 >tr|A7NWE6|A7NWE6_VITVI Chromosome chr5 scaffold_2, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00019890001 PE=4 SV=1 Length = 340 Score = 52 bits (124), Expect = 7e-006 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = +3 Query: 285 FASSEEVDLSQDVQLWEALIDSKKHFISHVLAF 383 F ++EEVDLS DVQ WE+L +S+KHFISHVLAF Sbjct: 50 FWTAEEVDLSHDVQQWESLSNSEKHFISHVLAF 82 >tr|B9RSS1|B9RSS1_RICCO Ribonucleoside-diphosphate reductase small chain, putative OS=Ricinus communis GN=RCOM_0678140 PE=4 SV=1 Length = 342 Score = 52 bits (124), Expect = 7e-006 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +3 Query: 285 FASSEEVDLSQDVQLWEALIDSKKHFISHVLAF 383 F ++EEVDLSQDVQ WE L S+KHFISHVLAF Sbjct: 51 FWTAEEVDLSQDVQQWETLSVSEKHFISHVLAF 83 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 602,918,336,817 Number of Sequences: 7695149 Number of Extensions: 602918336817 Number of Successful Extensions: 485147771 Number of sequences better than 0.0: 0 |