BLASTX 7.6.2 Query= RU45204 /QuerySize=174 (173 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9I150|B9I150_POPTR Predicted protein OS=Populus trichocarpa ... 54 4e-006 tr|B9STZ0|B9STZ0_RICCO Cell differentiation protein rcd1, putati... 54 4e-006 >tr|B9I150|B9I150_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_805875 PE=4 SV=1 Length = 320 Score = 54 bits (127), Expect = 4e-006 Identities = 30/51 (58%), Positives = 34/51 (66%), Gaps = 4/51 (7%) Frame = +2 Query: 29 PKSSSCMYPPFGGPIGSKPGSAGAPP---DPEMASAEHLVLELRNPQLREN 172 P+S S M PFGGP S P +A P D +MASAEHLVL+L NP LREN Sbjct: 5 PQSLS-MNTPFGGPSASNPAAAAGAPANKDRKMASAEHLVLDLSNPDLREN 54 >tr|B9STZ0|B9STZ0_RICCO Cell differentiation protein rcd1, putative OS=Ricinus communis GN=RCOM_0752590 PE=4 SV=1 Length = 328 Score = 54 bits (127), Expect = 4e-006 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 3/50 (6%) Frame = +2 Query: 29 PKSSSCMYPPFGGPIGSKPGSAGAP--PDPEMASAEHLVLELRNPQLREN 172 P+S S M FGGP S P +AGAP D +MASAEHLVL+L NP LREN Sbjct: 5 PQSLS-MNAQFGGPSASTPTAAGAPANKDRKMASAEHLVLDLSNPDLREN 53 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 602,918,336,817 Number of Sequences: 7695149 Number of Extensions: 602918336817 Number of Successful Extensions: 485147771 Number of sequences better than 0.0: 0 |