BLASTX 7.6.2 Query= RU52907 /QuerySize=281 (280 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|Q9M9T8|Q9M9T8_ARATH F6A14.22 protein OS=Arabidopsis thaliana ... 53 5e-006 >tr|Q9M9T8|Q9M9T8_ARATH F6A14.22 protein OS=Arabidopsis thaliana GN=At1g18670 PE=1 SV=1 Length = 662 Score = 53 bits (126), Expect = 5e-006 Identities = 26/32 (81%), Positives = 27/32 (84%), Gaps = 1/32 (3%) Frame = +3 Query: 96 MGCVSSKQTVSVTPAFDHSGAFRDNV-GNSGR 188 MGCV+SKQTVSVTPA DHSG FRDNV SGR Sbjct: 1 MGCVNSKQTVSVTPAIDHSGVFRDNVCSGSGR 32 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 656,936,227,776 Number of Sequences: 7695149 Number of Extensions: 656936227776 Number of Successful Extensions: 530353356 Number of sequences better than 0.0: 0 |