BLASTX 7.6.2 Query= RU55704 /QuerySize=252 (251 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|A5C6D9|A5C6D9_VITVI Putative uncharacterized protein OS=Vitis... 63 5e-009 tr|B9STJ4|B9STJ4_RICCO Putative uncharacterized protein OS=Ricin... 62 1e-008 >tr|A5C6D9|A5C6D9_VITVI Putative uncharacterized protein OS=Vitis vinifera GN=VITISV_017371 PE=4 SV=1 Length = 583 Score = 63 bits (152), Expect = 5e-009 Identities = 29/55 (52%), Positives = 37/55 (67%), Gaps = 1/55 (1%) Frame = +1 Query: 1 GFHSGPFEKAVVVKKGSSFKPQFDSRRGGELALFRAEDFNFPCGTSPGRLFMDCL 165 G+HSG E+A V KKG+ + Q +R E R +DF+FPCG SPGRLFM+CL Sbjct: 275 GYHSGAIERAAVEKKGTVIRXQMGLQR-SEFGAVRPDDFSFPCGASPGRLFMECL 328 >tr|B9STJ4|B9STJ4_RICCO Putative uncharacterized protein OS=Ricinus communis GN=RCOM_0492410 PE=4 SV=1 Length = 588 Score = 62 bits (148), Expect = 1e-008 Identities = 31/55 (56%), Positives = 37/55 (67%), Gaps = 4/55 (7%) Frame = +1 Query: 1 GFHSGPFEKAVVVKKGSSFKPQFDSRRGGELALFRAEDFNFPCGTSPGRLFMDCL 165 GF SGP VV ++ +S K Q D +RG E A+FR E+ FPC TSPGR FMDCL Sbjct: 296 GFQSGP----VVTRRETSIKHQVDLQRGEEEAVFRTEEIIFPCVTSPGRFFMDCL 346 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 686,278,792,274 Number of Sequences: 7695149 Number of Extensions: 686278792274 Number of Successful Extensions: 557580399 Number of sequences better than 0.0: 0 |