BLASTX 7.6.2 Query= RU56577 /QuerySize=190 (189 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|B9SAN6|B9SAN6_RICCO Thiamin pyrophosphokinase, putative OS=Ri... 57 5e-007 tr|A7Q0A5|A7Q0A5_VITVI Chromosome chr7 scaffold_42, whole genome... 54 4e-006 tr|B9I9S9|B9I9S9_POPTR Predicted protein OS=Populus trichocarpa ... 53 5e-006 >tr|B9SAN6|B9SAN6_RICCO Thiamin pyrophosphokinase, putative OS=Ricinus communis GN=RCOM_1177290 PE=4 SV=1 Length = 257 Score = 57 bits (135), Expect = 5e-007 Identities = 26/40 (65%), Positives = 32/40 (80%) Frame = -2 Query: 122 MELMSHSSTFLLPAPSNQSPPSLTYALVVLNQSLPRFSPL 3 ME+M+HSS FLLP S+ PSL YAL+VLNQ LP+F+PL Sbjct: 1 MEVMTHSSAFLLPTISDDHHPSLNYALIVLNQHLPKFTPL 40 >tr|A7Q0A5|A7Q0A5_VITVI Chromosome chr7 scaffold_42, whole genome shotgun sequence OS=Vitis vinifera GN=GSVIVT00027976001 PE=4 SV=1 Length = 256 Score = 54 bits (127), Expect = 4e-006 Identities = 27/40 (67%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = -2 Query: 122 MELMSHSSTFLLPAPSNQSPPSLTYALVVLNQSLPRFSPL 3 M+LM HSS FLLP+ + PP TYALVVLNQ LPRF+PL Sbjct: 1 MDLMRHSSAFLLPSIPDDGPPP-TYALVVLNQRLPRFTPL 39 >tr|B9I9S9|B9I9S9_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_572707 PE=4 SV=1 Length = 254 Score = 53 bits (126), Expect = 5e-006 Identities = 27/40 (67%), Positives = 32/40 (80%), Gaps = 2/40 (5%) Frame = -2 Query: 122 MELMSHSSTFLLPAPSNQSPPSLTYALVVLNQSLPRFSPL 3 ME+M+HSSTFLL PSN S+TYAL VLN+ LPRF+PL Sbjct: 1 MEVMTHSSTFLL--PSNHHSSSVTYALAVLNRPLPRFTPL 38 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 691,195,549,901 Number of Sequences: 7695149 Number of Extensions: 691195549901 Number of Successful Extensions: 566482183 Number of sequences better than 0.0: 0 |