BLASTX 7.6.2 Query= RU57793 /QuerySize=237 (236 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|A9PIJ3|A9PIJ3_POPTR Predicted protein OS=Populus trichocarpa ... 55 1e-006 >tr|A9PIJ3|A9PIJ3_POPTR Predicted protein OS=Populus trichocarpa GN=POPTRDRAFT_822061 PE=2 SV=1 Length = 338 Score = 55 bits (132), Expect = 1e-006 Identities = 25/45 (55%), Positives = 34/45 (75%), Gaps = 1/45 (2%) Frame = +3 Query: 84 MERDFMGLSSRESVAVIKEENIDDACRDSGGLTRGAGSNWPFSKQ 218 MERDF+GLSS++ AV+KEE D C+D G T+G+G +WPFS + Sbjct: 1 MERDFLGLSSKKPSAVVKEEISSDGCKDI-GFTKGSGMHWPFSNK 44 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 700,548,253,418 Number of Sequences: 7695149 Number of Extensions: 700548253418 Number of Successful Extensions: 584308295 Number of sequences better than 0.0: 0 |