BLASTX 7.6.2 Query= RU59863 /QuerySize=314 (313 letters) Database: UniProt/TrEMBL; 7,695,149 sequences; 2,506,224,640 total letters Score E Sequences producing significant alignments: (bits) Value tr|A6L5K4|A6L5K4_BACV8 Putative uncharacterized protein OS=Bacte... 77 4e-013 tr|B6VZD8|B6VZD8_9BACE Putative uncharacterized protein OS=Bacte... 75 1e-012 >tr|A6L5K4|A6L5K4_BACV8 Putative uncharacterized protein OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=BVU_3342 PE=4 SV=1 Length = 447 Score = 77 bits (187), Expect = 4e-013 Identities = 35/37 (94%) Frame = -1 Query: 310 GFAGIWWSISITSTMKGIICLIWFMLIKKKALNYQAV 200 G GIWWSISITSTMKGIICLIWFMLIKKKALNYQAV Sbjct: 411 GLPGIWWSISITSTMKGIICLIWFMLIKKKALNYQAV 447 >tr|B6VZD8|B6VZD8_9BACE Putative uncharacterized protein OS=Bacteroides dorei DSM 17855 GN=BACDOR_02645 PE=4 SV=1 Length = 447 Score = 75 bits (183), Expect = 1e-012 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -1 Query: 310 GFAGIWWSISITSTMKGIICLIWFMLIKKKALNYQAV 200 G GIWWSISITSTMKGIICLIWF+LIKKKALNYQAV Sbjct: 411 GLPGIWWSISITSTMKGIICLIWFILIKKKALNYQAV 447 Database: UniProt/TrEMBL Posted date: Sun May 10 14:41:50 2009 Number of letters in database: 2,506,224,640 Number of sequences in database: 7,695,149 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 708,861,941,928 Number of Sequences: 7695149 Number of Extensions: 708861941928 Number of Successful Extensions: 601401551 Number of sequences better than 0.0: 0 |