EST translation and GO annotation for unigene RU02130


ESTScan predicted protein sequence

MDPSVMQNPELASIINQEQQRAMVNEMVGKLTSA

ESTScan predicted coding region in original sequence      Start : 110 End : 211 Strand : minus

GACGACTCTCTGAGGTTTAGGGTTTTTTCGTTAGAGCGTGCCTCTCTCTCTCTCTCTCTCTAAGCTGAAGTCCTTGAAGGGTTTATCGAA
TTAGAAAGCACTAAAGTCCATGGATCCTTCAGTCATGCAAAACCCTGAGCTGGCCAGCATCATAAATCAAGAGCAGCAAAGGGCGATGGT
CAATGAGATGGTGGGAAAGCTTACGAGTGCA


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU02130 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006626-protein targeting to mitochondrion
  GO:0006810-transport
  GO:0015031-protein transport
  GO:0045039-protein import into mitochondrial inner membrane
  GO:0065002-intracellular protein transmembrane transport
GO Molecular Function
   GO:0008270-zinc ion binding
  GO:0046872-metal ion binding
GO Cellular Component
   GO:0005739-mitochondrion
  GO:0005743-mitochondrial inner membrane
  GO:0016020-membrane
  GO:0042719-mitochondrial intermembrane space protein transporter complex