EST translation and GO annotation for unigene RU07394


ESTScan predicted protein sequence

DEDDGDGDNKNKKKKRKKYHRHTTEQIREMEALFKESPHPDEKQRQQLSKQLGLAPRQVKFWFQNRRTQIKAIQERHEX

ESTScan predicted coding region in original sequence      Start : 1 End : 236 Strand : plus


GATGAAGATGATGGAGATGGAGACAACAAGAACAAGAAGAAAAAGAGAAAAAAGTACCATAGGCACACCACTGAGCAAATCCGAGAAATG
GAAGCGCTGTTCAAGGAGTCACCCCATCCAGATGAGAAGCAAAGACAGCAGCTGAGCAAGCAGTTAGGCCTTGCTCCAAGGCAAGTCAAG
TTTTGGTTCCAAAATCGCCGTACCCAAATCAAGGCTATACAAGAGCGCCATGAAAAX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00046    Homeobox domain

        GO:0003700     GO:0003700

        GO:0005634     GO:0005634

        GO:0006355     GO:0006355

        GO:0043565     GO:0043565

GO terms for RU07394 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
  GO:0006355-regulation of transcription, DNA-dependent
  GO:0045449-regulation of transcription
GO Molecular Function
  GO:0003677-DNA binding
  GO:0003700-transcription factor activity
  GO:0030528-transcription regulator activity
  GO:0043565-sequence-specific DNA binding
GO Cellular Component
  GO:0005634-nucleus