EST translation and GO annotation for unigene RU07668


ESTScan predicted protein sequence

MKRKILIVEDNISLSQMQKDWFAQAGYDAVTAMNEPVARSLIRKITFDLILSDVRLPEGDGX

ESTScan predicted coding region in original sequence      Start : 58 End : 241 Strand : minus

TGGAATATACCGCCATGCTGATAGCGGAAGCGAAGAACGAAATAAAAAAACTGGAAAATGAAACGGAAAATACTGATAGTTGAGGACAAT
ATAAGCTTGTCGCAGATGCAGAAGGACTGGTTTGCACAGGCGGGATATGATGCGGTAACGGCCATGAACGAGCCGGTTGCCCGCTCGTTG
ATACGTAAGATTACATTCGATTTGATTCTTTCGGATGTGCGTCTGCCGGAAGGGGACGGCAXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00072    Response regulator receiver domain

        GO:0000156     GO:0000156

        GO:0000160     GO:0000160

        GO:0006355     GO:0006355

GO terms for RU07668 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0000160-two-component signal transduction system (phosphorelay)
  GO:0006350-transcription
  GO:0006355-regulation of transcription, DNA-dependent
GO Molecular Function
   GO:0000156-two-component response regulator activity
  GO:0000166-nucleotide binding
  GO:0003700-transcription factor activity
  GO:0005524-ATP binding
  GO:0008134-transcription factor binding
  GO:0017111-nucleoside-triphosphatase activity
GO Cellular Component
   GO:0005622-intracellular