EST translation and GO annotation for unigene RU12393


ESTScan predicted protein sequence

EIRDPAKNGARVWLGTYETSEEAAVAYDRAAYRMRGAKX

ESTScan predicted coding region in original sequence      Start : 1 End : 115 Strand : plus


GAGATTCGAGATCCGGCGAAGAACGGGGCTCGAGTGTGGCTTGGCACCTATGAGACCTCCGAGGAAGCGGCTGTGGCTTATGACCGAGCC
GCTTACCGGATGCGTGGTGCCAAGGXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00847    AP2 domain

        GO:0003700     GO:0003700

        GO:0006355     GO:0006355

GO terms for RU12393 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
  GO:0006350-transcription
  GO:0006355-regulation of transcription, DNA-dependent
GO Molecular Function
  GO:0003677-DNA binding
  GO:0003700-transcription factor activity
GO Cellular Component
  GO:0005634-nucleus