Rose Transcriptome Database

EST translation and GO annotation for unigene RU14516

ESTScan predicted protein sequence

XDLYLPHTHCSCLAHQQAXEAAAAAAPRHYSIPFNRSSFPASFIFGAGSAAYQTEGAAHIHGKGPSIWX

ESTScan predicted coding region in original sequence Start : 1 End : 203 Strand : minus

XTTGATCTTTATCTGCCTCATACTCACTGCTCTTGTTTGGCTCATCAGCAAGCAATXGAGGCGGCTGCTGCTGCTGCTCCTCGTCATTAT
TCGATTCCATTCAATAGAAGTAGCTTCCCAGCTAGTTTCATCTTCGGAGCTGGTTCTGCTGCTTATCAGACTGAAGGAGCAGCACATATC
CATGGAAAGGGACCAAGCATATGGGXX

X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS

InterProtein domain annotations

Pfam domain annotations

PF00232    Glycosyl hydrolase family 1

        GO:0004553     GO:0004553

        GO:0005975     GO:0005975

GO terms for RU14516 (based on the top Swiss-Prot and TrEMBL hits)

GO Biological Process

GO:0005975-carbohydrate metabolic process
GO:0008152-metabolic process

GO Molecular Function

  GO:0003824-catalytic activity
  GO:0004553-hydrolase activity, hydrolyzing O-glycosyl compounds
  GO:0016787-hydrolase activity
  GO:0016798-hydrolase activity, acting on glycosyl bonds
  GO:0043169-cation binding
  GO:0050535-beta-primeverosidase activity