EST translation and GO annotation for unigene RU14742


ESTScan predicted protein sequence

KNHRTQVARACWGLRAKRRWCLSGTPIQNAIDDLYSYFRFLRYDPYAVYKSFCA

ESTScan predicted coding region in original sequence      Start : 1 End : 161 Strand : minus


AAGAATCACAGAACTCAAGTAGCTAGGGCCTGTTGGGGGCTTCGAGCGAAACGTAGGTGGTGCTTATCGGGGACACCTATCCAGAATGCG
ATTGATGATCTTTATAGCTACTTCAGATTTCTGAGATATGACCCTTATGCGGTGTACAAGTCGTTTTGTGCX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00176    SNF2 family N-terminal domain

        GO:0003677     GO:0003677

        GO:0005524     GO:0005524

GO terms for RU14742 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
   GO:0003676-nucleic acid binding
  GO:0003677-DNA binding
  GO:0004386-helicase activity
  GO:0005515-protein binding
  GO:0005524-ATP binding
  GO:0008270-zinc ion binding
  GO:0046872-metal ion binding
GO Cellular Component