EST translation and GO annotation for unigene RU14892


ESTScan predicted protein sequence

RHSAQQKDDRKILKRWQWSCVLMDEAHALKDKNSYRWKNLMSVARSANHNHRX

ESTScan predicted coding region in original sequence      Start : 1 End : 157 Strand : plus


AGACACAGTGCACAGCAGAAAGATGATCGTAAGATTCTGAAACGTTGGCAGTGGAGTTGTGTTCTTATGGATGAGGCTCATGCTCTGAAG
GATAAAAACAGCTACAGGTGGAAGAACCTAATGTCTGTTGCAAGAAGTGCAAACCACAATCACAGGAXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU14892 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
   GO:0003676-nucleic acid binding
  GO:0003677-DNA binding
  GO:0004386-helicase activity
  GO:0005524-ATP binding
GO Cellular Component