EST translation and GO annotation for unigene RU14901


ESTScan predicted protein sequence

XLARQQTPMPSSVISSQSMHLGVLATASHAVMTSTLFVVYYKPRTSQFIVGLNKYLEAINNKFSVX

ESTScan predicted coding region in original sequence      Start : 1 End : 195 Strand : plus


XGTCTTGCTCGTCAACAGACTCCCATGCCTTCATCAGTGATATCTAGCCAAAGTATGCATCTTGGAGTGCTTGCAACTGCTTCTCATGCT
GTTATGACCTCAACTCTCTTTGTTGTCTATTACAAGCCCAGGACAAGCCAATTTATTGTTGGCTTAAACAAATATCTTGAAGCCATCAAC
AATAAGTTTTCTGTTGXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF06507    Auxin response factor

        GO:0003677     GO:0003677

        GO:0005634     GO:0005634

        GO:0009725     GO:0009725

        GO:0045449     GO:0045449

GO terms for RU14901 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
  GO:0006355-regulation of transcription, DNA-dependent
  GO:0009725-response to hormone stimulus
  GO:0045449-regulation of transcription
GO Molecular Function
  GO:0003677-DNA binding
  GO:0046983-protein dimerization activity
GO Cellular Component
  GO:0005634-nucleus