EST translation and GO annotation for unigene RU15188


ESTScan predicted protein sequence

MATFELYRRSTIGMCLTETLDEMVQNATLSPELAIQV

ESTScan predicted coding region in original sequence      Start : 121 End : 230 Strand : minus

ATTTTTTCTGCGCTCAGAAAAAAGGCTTCCGAAGCTCAACGTTCACAGAGAGAGAGAGCACGACACTCAGACCCCCAACAATCTCCTCTA
CAGCGTCGCCACCAAAATCCATCGAAGAAAATGGCGACGTTTGAGCTCTACAGGAGGTCAACGATCGGAATGTGCCTGACTGAGACTTTG
GATGAGATGGTTCAGAACGCGACTCTCAGTCCTGAGCTTGCCATTCAGGTX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF02268    Transcription initiation factor IIA, gamma subunit, helical domain

        GO:0003702     GO:0003702

        GO:0005672     GO:0005672

        GO:0006367     GO:0006367

GO terms for RU15188 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006367-transcription initiation from RNA polymerase II promoter
GO Molecular Function
   GO:0003702-RNA polymerase II transcription factor activity
GO Cellular Component
   GO:0005672-transcription factor TFIIA complex