EST translation and GO annotation for unigene RU16550


ESTScan predicted protein sequence

MEKAGAIAVSAMDAFEKLEKVGEGTYGKVYRAREKATGKIVAL

ESTScan predicted coding region in original sequence      Start : 65 End : 196 Strand : minus

GTCCTCCTCACTTCCACAATCGAAATCAAATTGTAGAGACAGAGAGAGAAAGAGAGAGAGAGAAATGGAGAAGGCAGGAGCGATCGCAGT
GTCGGCGATGGACGCGTTCGAGAAACTGGAGAAGGTCGGAGAAGGGACCTACGGCAAGGTTTACAGAGCCAGAGAGAAGGCCACCGGCAA
GATCGTCGCCCTCTAAAAGACTCGCCTCCATGAGGACGAAGAAGG


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00069    Protein kinase domain

        GO:0004672     GO:0004672

        GO:0005524     GO:0005524

        GO:0006468     GO:0006468

GO terms for RU16550 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006468-protein amino acid phosphorylation
GO Molecular Function
   GO:0000166-nucleotide binding
  GO:0004672-protein kinase activity
  GO:0004674-protein serine/threonine kinase activity
  GO:0005524-ATP binding
  GO:0016301-kinase activity
GO Cellular Component