EST translation and GO annotation for unigene RU16852


ESTScan predicted protein sequence

MKVCEKVESKGRTTYNEVADELVAEFSDPINGVTSPDQQQYDEKNIRRRVYDALNVLMAMDIISKDKKEIQWKGLPRTSLX

ESTScan predicted coding region in original sequence      Start : 1 End : 242 Strand : plus


ATGAAAGTGTGCGAGAAAGTGGAGAGCAAGGGAAGAACCACTTATAATGAGGTTGCAGATGAACTTGTAGCAGAGTTTTCTGACCCTATC
AATGGTGTTACATCTCCTGATCAGCAACAATATGATGAGAAGAACATCAGGCGGAGGGTATATGATGCCCTGAATGTTCTAATGGCAATG
GATATTATATCCAAGGATAAAAAAGAAATACAATGGAAGGGTCTGCCTCGAACCAGCCTGAAX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF02319    E2F/DP family winged-helix DNA-binding domain

        GO:0003700     GO:0003700

        GO:0005667     GO:0005667

        GO:0006355     GO:0006355

GO terms for RU16852 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0000084-S phase of mitotic cell cycle
  GO:0006350-transcription
  GO:0006355-regulation of transcription, DNA-dependent
  GO:0006915-apoptosis
  GO:0008544-epidermis development
  GO:0045449-regulation of transcription
  GO:0045893-positive regulation of transcription, DNA-dependent
GO Molecular Function
   GO:0003677-DNA binding
  GO:0003700-transcription factor activity
  GO:0005515-protein binding
  GO:0016563-transcription activator activity
GO Cellular Component
   GO:0005634-nucleus
  GO:0005667-transcription factor complex