EST translation and GO annotation for unigene RU17061


ESTScan predicted protein sequence

MEFPKQITPADDPESSSQKKLGRGKIEIKRIENTTNRQVTFCKRRNGLLKKAYX

ESTScan predicted coding region in original sequence      Start : 103 End : 263 Strand : plus

ACCAAAACAAAGAATCAAAAGAGAGACTCAACTCTACAAATAAGAACTAAGATATTCAATTTGGGGTAGTTTTTACCATTTTGATCGTCT
TTGCAAATTATCATGGAGTTCCCAAAACAAATTACACCAGCTGATGATCCTGAGAGCTCTTCCCAAAAGAAATTGGGAAGAGGGAAAATC
GAGATCAAGAGGATCGAAAACACTACCAATCGACAAGTCACATTCTGCAAGCGTCGCAACGGTTTGCTTAAGAAAGCATATGAX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00319    SRF-type transcription factor (DNA-binding and dimerisation domain)

        GO:0003700     GO:0003700

        GO:0005634     GO:0005634

        GO:0006355     GO:0006355

        GO:0043565     GO:0043565

GO terms for RU17061 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
  GO:0006350-transcription
  GO:0006355-regulation of transcription, DNA-dependent
GO Molecular Function
  GO:0003677-DNA binding
  GO:0003700-transcription factor activity
  GO:0043565-sequence-specific DNA binding
GO Cellular Component
  GO:0005634-nucleus