EST translation and GO annotation for unigene RU18358


ESTScan predicted protein sequence

PEEIEGECPFMAIDEPCPYGLSCRFLGTHKNGVADGDVNARRRSSEMNGLSKNVQKLLR

ESTScan predicted coding region in original sequence      Start : 1 End : 178 Strand : plus


CCTGAGGAGATTGAGGGAGAATGTCCTTTTATGGCTATTGATGAGCCATGCCCTTATGGTTTGTCATGTAGGTTCTTGGGTACACATAAA
AATGGTGTTGCAGATGGAGATGTGAATGCTCGTAGAAGAAGCTCTGAGATGAATGGATTAAGCAAAAATGTTCAAAAGCTTTTGAGG


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU18358 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0008033-tRNA processing
  GO:0008152-metabolic process
  GO:0055114-oxidation reduction
GO Molecular Function
   GO:0003676-nucleic acid binding
  GO:0003824-catalytic activity
  GO:0008270-zinc ion binding
  GO:0017150-tRNA dihydrouridine synthase activity
  GO:0050660-FAD binding
GO Cellular Component