EST translation and GO annotation for unigene RU18624


ESTScan predicted protein sequence

MLSPHILGEEHYNTARGVQKVLQNYKNLQDIIAILGMDELSEDDKLTVARAT

ESTScan predicted coding region in original sequence      Start : 163 End : 321 Strand : minus

CTTTGGAAATTCAGGATAACAGAAAATAGCCACATGACCTAAGCATTTTCCTTGGCAATCTTCTCTGCCTTAGCAATGACTTCTTCAATT
CCACCAACCATATAGAACGATTGCTCAGAAAGATCATCATATTTCCCATCCAGAACTCCCTGGAAACTGGTAATGCTCTCGCCTCATATT
CTAGGAGAAGAACACTACAACACTGCTCGTGGTGTTCAGAAAGTTCTTCAAAACTATAAGAATCTGCAAGATATTATTGCAATTTTGGGG
ATGGATGAGCTTAGTGAAGATGACAAATTGACTGTTGCTCGTGCTACGTAAAAATTACAAACGGTTACTTAGAAGACCAAACCTTT


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00306    ATP synthase alpha/beta chain, C terminal domain

        GO:0015986     GO:0015986

        GO:0016820     GO:0016820

        GO:0033178     GO:0033178

GO terms for RU18624 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006754-ATP biosynthetic process
  GO:0006810-transport
  GO:0006811-ion transport
  GO:0015986-ATP synthesis coupled proton transport
  GO:0015992-proton transport
  GO:0046034-ATP metabolic process
GO Molecular Function
   GO:0000166-nucleotide binding
  GO:0005524-ATP binding
  GO:0008553-hydrogen-exporting ATPase activity, phosphorylative mechanism
  GO:0015078-hydrogen ion transmembrane transporter activity
  GO:0016820-hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
  GO:0017111-nucleoside-triphosphatase activity
  GO:0046933-hydrogen ion transporting ATP synthase activity, rotational mechanism
  GO:0046961-proton-transporting ATPase activity, rotational mechanism
GO Cellular Component
   GO:0016469-proton-transporting two-sector ATPase complex
  GO:0033178-proton-transporting two-sector ATPase complex, catalytic domain
  GO:0045261-proton-transporting ATP synthase complex, catalytic core F(1)