EST translation and GO annotation for unigene RU20394


ESTScan predicted protein sequence

MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGITSIGVRGKDSVCVVTQKKVPX

ESTScan predicted coding region in original sequence      Start : 74 End : 245 Strand : plus

CAGAAACCCAAAGCCCTAAAGCAGATAGAAGGAAGAAGAAGAAGAAGAAGAAGCGGAAGCTCCGAAATCGAATATGAGTCGTGGTAGTGG
TGGAGGATACGACCGTCATATCACGATCTTCTCACCCGAAGGTCGTCTTTTCCAAGTCGAATATGCGTTTAAGGCTGTCAAGTCTGCTGG
GATTACCTCCATTGGTGTCCGAGGGAAGGATTCAGTATGTGTTGTGACTCAGAAGAAAGTCCCGGXX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF10584    Proteasome subunit A N-terminal signature

        GO:0004175     GO:0004175

        GO:0005839     GO:0005839

        GO:0006511     GO:0006511

GO terms for RU20394 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
   GO:0006511-ubiquitin-dependent protein catabolic process
  GO:0051603-proteolysis involved in cellular protein catabolic process
GO Molecular Function
   GO:0004175-endopeptidase activity
  GO:0004298-threonine-type endopeptidase activity
  GO:0008233-peptidase activity
  GO:0016787-hydrolase activity
GO Cellular Component
   GO:0005829-cytosol
  GO:0005839-proteasome core complex
  GO:0043234-protein complex