EST translation and GO annotation for unigene RU20620


ESTScan predicted protein sequence

MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKG

ESTScan predicted coding region in original sequence      Start : 51 End : 178 Strand : plus

GAGAAAAAGTCTTGTGTGTTGTGAATTGAATTGGGTTAGGACTTAGGAGGATGGCAACATTTGCAGGGACGACCCAGAAGTGTAAGGCAT
GTGAGAAGACTGTGTACTTGGTTGATCAGCTCACTGCTGACAACAAAGTCTACCACAAGGCTTGTTTCAGATGCCACCACTGCAAAGGX


X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

PF00412    LIM domain

        GO:0008270     GO:0008270

GO terms for RU20620 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
   GO:0008270-zinc ion binding
GO Cellular Component