EST translation and GO annotation for unigene RU22261


ESTScan predicted protein sequence

XPPPPPPPKPRNDYPRTTSAGFDPDPLERGAKYAKDISNSKDAKKIFEVLKKQEETRQVE

ESTScan predicted coding region in original sequence      Start : 1 End : 179 Strand : minus


XCTCCTCCTCCTCCTCCTCCGCCGAAGCCTCGCAATGATTACCCGAGGACTACTTCGGCCGGGTTCGATCCCGACCCGCTGGAGCGCGGT
GCCAAGTATGCCAAAGATATCAGCAACTCTAAGGATGCCAAAAAGATATTTGAAGTTCTGAAGAAGCAAGAAGAGACGAGGCAGGTTGAG



X -- added by ESTScan; agctn -- deleted by ESTScan; AGCTN -- CDS



InterProtein domain annotations

Pfam domain annotations

GO terms for RU22261 (based on the top Swiss-Prot and TrEMBL hits)


GO Biological Process
GO Molecular Function
   GO:0000166-nucleotide binding
  GO:0005524-ATP binding
  GO:0017111-nucleoside-triphosphatase activity
GO Cellular Component